GlyCosmos Portal

Submissions

Beta-1,3-galactosyltransferase bre-5

Summary

UniProt ID: Q95US5
Gene Symbol: T12G3.8 bre-5
Gene ID: 178142
Organism: Caenorhabditis elegans

External Links

Re-Glyco: Q95US5

Annotation

Keyword: Glycoprotein Glycosyltransferase Golgi apparatus Insecticide resistance Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein O-linked glycosylation
response to toxic substance	IMP	PMID
carbohydrate biosynthetic process	IMP	PMID
regulation of mesodermal cell fate specification	IMP	PMID
regulation of mesodermal cell fate specification	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

carbohydrate biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

primary metabolic process [inference]

carbohydrate metabolic process [inference]

carbohydrate biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

response to stimulus [inference]

response to chemical [inference]

response to toxic substance

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

regulation of developmental process [inference]

regulation of cell fate commitment [inference]

regulation of cell fate specification [inference]

regulation of mesodermal cell fate specification

regulation of anatomical structure morphogenesis [inference]

regulation of animal organ morphogenesis [inference]

regulation of mesodermal cell fate specification

regulation of cell differentiation [inference]

regulation of mesodermal cell differentiation [inference]

regulation of mesodermal cell fate specification

regulation of cellular process [inference]

regulation of cell fate commitment [inference]

regulation of cell fate specification [inference]

regulation of mesodermal cell fate specification

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

regulation of cell differentiation [inference]

regulation of mesodermal cell differentiation [inference]

regulation of mesodermal cell fate specification

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Notch signaling pathway

Displaying 1 entry
GO Term	Evidence Code	Reference
Golgi membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
UDP-glycosyltransferase activity	IBA	GO_REF
acetylglucosaminyltransferase activity	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity

acetylglucosaminyltransferase activity

hexosyltransferase activity [inference]

acetylglucosaminyltransferase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFLCVRILKRKYHELSSFQKLLIFTITIFLLWVLGVVDKFRETSFGDFSWPLETRNLQLRSKFTKYPQCKFSGNGQKIIIIIIKSSAKNGPMRESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVFTGILAKTVNVAATHNENFIFWCRRVSQKEWDDGVIAVHGYARKDLEYEYSQLNGFE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
150	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Glycosphingolipid biosynthesis	Caenorhabditis elegans
Lewis blood group biosynthesis	Caenorhabditis elegans
O-linked glycosylation of mucins	Caenorhabditis elegans

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements