GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

U7 snRNA-associated Sm-like protein LSm10

Summary

UniProt ID: Q969L4
Gene Symbol: LSM10
Gene ID: 84967
Organism: Homo sapiens (human)

External Links

GlyGen: Q969L4
PubChem: Q969L4
The O-GlcNAc Database: Q969L4
O-GlcNAcAtlas: Q969L4
Re-Glyco: Q969L4

Annotation

Keyword: 3D-structure Nucleus Proteomics identification RNA-binding Reference proteome Ribonucleoprotein mRNA splicing

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
mRNA 3'-end processing by stem-loop binding and cleavage	IBA	GO_REF
RNA splicing
positive regulation of G1/S transition of mitotic cell cycle	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA 3'-end processing [inference]

mRNA 3'-end processing by stem-loop binding and cleavage

histone mRNA metabolic process [inference]

mRNA 3'-end processing by stem-loop binding and cleavage

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA 3'-end processing [inference]

mRNA 3'-end processing by stem-loop binding and cleavage

histone mRNA metabolic process [inference]

mRNA 3'-end processing by stem-loop binding and cleavage

RNA processing [inference]

mRNA processing [inference]

mRNA 3'-end processing [inference]

mRNA 3'-end processing by stem-loop binding and cleavage

RNA splicing

RNA 3'-end processing [inference]

mRNA 3'-end processing [inference]

mRNA 3'-end processing by stem-loop binding and cleavage

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle process [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of cellular process [inference]

positive regulation of cellular process [inference]

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle process [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of mitotic cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle process [inference]

positive regulation of cell cycle process [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle phase transition [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of mitotic cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle G1/S phase transition [inference]

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle process [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleoplasm	TAS	Reactome Reactome Reactome Reactome
nucleoplasm	IDA	GO_REF
U7 snRNP	NAS	PMID
U7 snRNP	IDA	PMID
Cajal body	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

Sm-like protein family complex [inference]

small nuclear ribonucleoprotein complex [inference]

U7 snRNP

nuclear protein-containing complex [inference]

small nuclear ribonucleoprotein complex [inference]

U7 snRNP

ribonucleoprotein complex [inference]

small nuclear ribonucleoprotein complex [inference]

U7 snRNP

cellular anatomical structure [inference]

nucleoplasm

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear ribonucleoprotein granule [inference]

Cajal body

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic U snRNP body

nuclear ribonucleoprotein granule [inference]

Cajal body

intracellular organelle [inference]

intracellular membraneless organelle [inference]

nuclear ribonucleoprotein granule [inference]

Cajal body

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic U snRNP body

nuclear ribonucleoprotein granule [inference]

Cajal body

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic U snRNP body

nuclear ribonucleoprotein granule [inference]

Cajal body

Displaying **all 5** entries
GO Term	Evidence Code	Reference
histone pre-mRNA DCP binding	ISS	GO_REF
histone pre-mRNA DCP binding	IBA	GO_REF
histone pre-mRNA DCP binding	IEA	GO_REF
U7 snRNA binding	IBA	GO_REF
U7 snRNA binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

RNA binding [inference]

snRNA binding [inference]

U7 snRNA binding

histone pre-mRNA DCP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
29		35254053 39894887 40596516	G49108TO	GlyGen The O-GlcNAc Database
30		35254053 39894887 40596516	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
RNA Polymerase II Transcription Termination	Homo sapiens
SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs	Homo sapiens
SLBP independent Processing of Histone Pre-mRNAs	Homo sapiens

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026