GlyCosmos Portal

Submissions

P2Y purinoceptor 11

Summary

UniProt ID: Q96G91
Gene Symbol: P2RY11
Gene ID: 5032
Organism: Homo sapiens (human)

External Links

GlyGen: Q96G91
PubChem: Q96G91
The Human Metabolome Database: HMDBP07862
Re-Glyco: Q96G91

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
defense response	TAS	PMID
G protein-coupled receptor signaling pathway	IDA	PMID
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF
activation of adenylate cyclase activity	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway

neuronal signal transduction

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to ATP

cellular response to oxygen-containing compound [inference]

cellular response to ATP

response to stimulus [inference]

response to stress [inference]

defense response

response to chemical [inference]

response to organophosphorus [inference]

response to ATP [inference]

cellular response to ATP

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to ATP

cellular response to oxygen-containing compound [inference]

cellular response to ATP

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to ATP [inference]

cellular response to ATP

cellular response to nitrogen compound [inference]

cellular response to ATP

response to oxygen-containing compound [inference]

response to ATP [inference]

cellular response to ATP

cellular response to oxygen-containing compound [inference]

cellular response to ATP

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to ATP

cellular response to oxygen-containing compound [inference]

cellular response to ATP

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway

neuronal signal transduction

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

positive regulation of lyase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

positive regulation of lyase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

regulation of adenylate cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane	TAS	PMID Reactome Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	IC	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
neurotransmitter receptor activity	IDA	PMID
neurotransmitter receptor activity	IBA	GO_REF
neurotransmitter receptor activity	IEA	GO_REF
signaling receptor activity	TAS	PMID
G protein-coupled ATP receptor activity	IDA	PMID

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled purinergic nucleotide receptor activity [inference]

G protein-coupled ATP receptor activity

nucleotide receptor activity [inference]

purinergic nucleotide receptor activity [inference]

G protein-coupled purinergic nucleotide receptor activity [inference]

G protein-coupled ATP receptor activity

neurotransmitter receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
4	N-linked (GlcNAc...) asparagine			UniProt GlyGen
179	N-linked (GlcNAc...) asparagine	24190977		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
G alpha (q) signalling events	Homo sapiens
G alpha (s) signalling events	Homo sapiens
P2Y receptors	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements