GlyCosmos Portal

Submissions

Hedgehog-interacting protein

Summary

UniProt ID: Q96QV1
Gene Symbol: HHIP HIP UNQ5825/PRO19644
Gene ID: 64399
Organism: Homo sapiens (human)

External Links

GlyGen: Q96QV1
PubChem: Q96QV1
Re-Glyco: Q96QV1

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Cytoplasm Disulfide bond EGF-like domain Glycoprotein Metal-binding Proteomics identification Reference proteome Repeat Secreted Signal Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
signal transduction
neuroblast proliferation
dorsal/ventral pattern formation
negative regulation of signal transduction	IDA	PMID
negative regulation of signal transduction	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cell population proliferation [inference]

neural precursor cell proliferation [inference]

neuroblast proliferation

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

pattern specification process [inference]

regionalization [inference]

dorsal/ventral pattern formation

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

animal organ morphogenesis [inference]

skeletal system morphogenesis

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

negative regulation of smoothened signaling pathway

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

negative regulation of smoothened signaling pathway

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of fibroblast growth factor receptor signaling pathway

regulation of cellular process [inference]

signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

negative regulation of smoothened signaling pathway

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
cytoplasm	IEA	GO_REF
plasma membrane	ISS	PMID
plasma membrane	IEA	GO_REF GO_REF GO_REF
cell surface	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

ciliary membrane

plasma membrane region [inference]

cell projection membrane [inference]

ciliary membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
zinc ion binding	IDA	PMID
hedgehog family protein binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

hedgehog family protein binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
99	N-linked (GlcNAc...) asparagine		G83460ZZ	UniProt GlyGen
416	N-linked (GlcNAc...) asparagine		G83460ZZ	UniProt GlyGen
447	N-linked (GlcNAc...) asparagine	19561611	G80920RR	UniProt GlyGen
459	N-linked (GlcNAc...) asparagine			UniProt GlyGen