GlyCosmos Portal

Submissions

Glial cell line-derived neurotrophic factor

Summary

UniProt ID

Q98TU0

Gene Symbol

gdnf

Gene ID

[""]

Organism

Danio rerio (zebrafish)

External Links

PubChem: Q98TU0
Re-Glyco: Q98TU0

Annotation

Keyword: 3D-structure Cleavage on pair of basic residues Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
metanephros development	ISS	GO_REF
branching involved in ureteric bud morphogenesis	ISS	GO_REF
neural crest cell migration	ISS	GO_REF
peripheral nervous system development
diencephalon development	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

glial cell-derived neurotrophic factor receptor signaling pathway

cell motility [inference]

cell migration [inference]

ameboidal-type cell migration [inference]

mesenchymal cell migration [inference]

neural crest cell migration

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development

protein-containing complex organization [inference]

protein-containing complex assembly

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

system process [inference]

muscle system process [inference]

muscle contraction [inference]

smooth muscle contraction [inference]

phasic smooth muscle contraction [inference]

peristalsis

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

anatomical structure development [inference]

diencephalon development

animal organ development [inference]

kidney development [inference]

metanephros development

system development [inference]

peripheral nervous system development

autonomic nervous system development [inference]

postganglionic parasympathetic fiber development

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of neurotransmitter transport [inference]

regulation of neurotransmitter uptake [inference]

regulation of dopamine uptake involved in synaptic transmission

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of developmental process [inference]

positive regulation of animal organ morphogenesis [inference]

positive regulation of ureteric bud formation

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in ureteric bud morphogenesis

positive regulation of epithelial tube formation [inference]

positive regulation of ureteric bud formation

positive regulation of multicellular organismal process [inference]

positive regulation of branching involved in ureteric bud morphogenesis

positive regulation of animal organ morphogenesis [inference]

positive regulation of ureteric bud formation

positive regulation of epithelial tube formation [inference]

positive regulation of ureteric bud formation

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of macromolecule metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of morphogenesis of a branching structure

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of morphogenesis of an epithelium [inference]

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of epithelial tube formation [inference]

regulation of ureteric bud formation [inference]

positive regulation of ureteric bud formation

positive regulation of epithelial tube formation [inference]

positive regulation of ureteric bud formation

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in ureteric bud morphogenesis

positive regulation of epithelial tube formation [inference]

positive regulation of ureteric bud formation

regulation of animal organ morphogenesis [inference]

regulation of ureteric bud formation [inference]

positive regulation of ureteric bud formation

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

positive regulation of animal organ morphogenesis [inference]

positive regulation of ureteric bud formation

regulation of cell differentiation [inference]

regulation of neuron differentiation [inference]

regulation of dopaminergic neuron differentiation

positive regulation of developmental process [inference]

positive regulation of animal organ morphogenesis [inference]

positive regulation of ureteric bud formation

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in ureteric bud morphogenesis

positive regulation of epithelial tube formation [inference]

positive regulation of ureteric bud formation

regulation of kidney development [inference]

regulation of mesonephros development [inference]

regulation of ureteric bud formation [inference]

positive regulation of ureteric bud formation

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of multicellular organismal development [inference]

regulation of epithelial tube formation [inference]

regulation of ureteric bud formation [inference]

positive regulation of ureteric bud formation

positive regulation of epithelial tube formation [inference]

positive regulation of ureteric bud formation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

glial cell-derived neurotrophic factor receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

post-transcriptional regulation of gene expression [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of macromolecule metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

post-transcriptional regulation of gene expression [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of RNA metabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of mRNA metabolic process [inference]

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of RNA metabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of mRNA metabolic process [inference]

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of neuron apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of cell differentiation [inference]

regulation of neuron differentiation [inference]

regulation of dopaminergic neuron differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of macromolecule metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of branching involved in ureteric bud morphogenesis

positive regulation of animal organ morphogenesis [inference]

positive regulation of ureteric bud formation

positive regulation of epithelial tube formation [inference]

positive regulation of ureteric bud formation

regulation of morphogenesis of a branching structure

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of multicellular organismal development [inference]

regulation of epithelial tube formation [inference]

regulation of ureteric bud formation [inference]

positive regulation of ureteric bud formation

positive regulation of epithelial tube formation [inference]

positive regulation of ureteric bud formation

regulation of biological quality [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

Displaying **all 3** entries
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
MAP kinase kinase kinase activity	IDA	PMID
growth factor activity	ISS	GO_REF
growth factor activity	IBA	GO_REF
growth factor activity	IEA	GO_REF
glial cell-derived neurotrophic factor receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity [inference]

MAP kinase kinase kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity [inference]

MAP kinase kinase kinase activity

catalytic activity, acting on a protein [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity [inference]

MAP kinase kinase kinase activity

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

receptor tyrosine kinase binding

growth factor receptor binding [inference]

glial cell-derived neurotrophic factor receptor binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein tyrosine kinase binding [inference]

receptor tyrosine kinase binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLWDILATCLLLLSSVSTRPLFHKLQPSKRAVVRSESPALDPIIDSQPETSNPKQASMEEQYDLTGLYPEQFEDVMDFIEATLGRLRRSSDVEPQMKRDRVRQKAAANTEKSGGRGRGERKRSRGRARSRDDRVKGQGRGCLLKEIHLNVTDLDLGYRTKEELIFRYCSGPCHDAETNYDKILNNLTHNKKLDKDTPSRTCCRPIAFDDDISFLDDSLEYHTLKKHSAKKCACV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
150	N-linked (GlcNAc...) asparagine			UniProt
186	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
RAF/MAP kinase cascade	Danio rerio
RET signaling	Danio rerio

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements