GlyCosmos Portal

Submissions

Proheparin-binding EGF-like growth factor

Summary

UniProt ID

Q99075

Gene Symbol

DTR
DTS
HBEGF
HEGFL

Gene ID

[1839]

Organism

Homo sapiens (human)

External Links

GlyConnect

Proheparin-binding EGF-like growth factor

GlyGen

Q99075

PubChem

Q99075

The Human Metabolome Database

HMDBP02701

Re-Glyco

Q99075

Annotation

Keyword: 3D-structure Cell membrane Direct protein sequencing Disulfide bond EGF-like domain Glycoprotein Growth factor Heparin-binding Proteomics identification Receptor Reference proteome Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
signal transduction	TAS	PMID
epidermal growth factor receptor signaling pathway	IDA	PMID
epidermal growth factor receptor signaling pathway	IMP	PMID
epidermal growth factor receptor signaling pathway	IBA	GO_REF
epidermal growth factor receptor signaling pathway	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

epidermal growth factor receptor signaling pathway

ERBB2-EGFR signaling pathway

ERBB2 signaling pathway [inference]

ERBB4 signaling pathway [inference]

ERBB2-ERBB4 signaling pathway

cell motility [inference]

cell migration [inference]

wound healing, spreading of cells [inference]

wound healing, spreading of epidermal cells

cell chemotaxis

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

muscle organ development

muscle structure development [inference]

muscle organ development

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth

positive regulation of growth [inference]

positive regulation of cell growth

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell growth

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to wounding [inference]

positive regulation of wound healing

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to wounding [inference]

positive regulation of wound healing

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

positive regulation of wound healing

positive regulation of response to wounding [inference]

positive regulation of wound healing

regulation of cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

epidermal growth factor receptor signaling pathway

ERBB2-EGFR signaling pathway

ERBB2 signaling pathway [inference]

ERBB4 signaling pathway [inference]

ERBB2-ERBB4 signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of macromolecule biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of glycoprotein biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of glycoprotein biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of protein metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of glycoprotein metabolic process [inference]

regulation of glycoprotein biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of glycoprotein metabolic process [inference]

regulation of glycoprotein biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell growth

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of multicellular organismal process [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

regulation of system process [inference]

regulation of blood circulation [inference]

regulation of heart contraction

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
epidermal growth factor receptor binding	TAS	PMID
epidermal growth factor receptor binding	IBA	GO_REF
epidermal growth factor receptor binding	IEA	GO_REF
growth factor activity	IDA	PMID
growth factor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

growth factor receptor binding [inference]

epidermal growth factor receptor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

receptor ligand activity

growth factor activity

molecular function activator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

signaling receptor activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

receptor ligand activity

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 11 in total

1

2

Next ›

Last »
Position	Description	PubMed ID	GlyTouCan ID	Source
32		23584533	G57321FI	GlyGen
37	O-linked (GalNAc...) threonine	23234360 30237853 30459171	G53434XO	UniProt GlyGen GlyConnect
38	O-linked (GalNAc...) serine	23234360		UniProt GlyGen
44	O-linked (GalNAc...) threonine	22171320 23234360 30237853 30459171	G48584BU G53434XO G29931IJ G43417UB	UniProt GlyGen GlyConnect
46		30237853	G50757KG	GlyGen GlyConnect
47	O-linked (GalNAc...) threonine	22171320 30237853 30459171	G81006GJ G53434XO G43417UB	UniProt GlyGen GlyConnect
74		23584533	G57321FI	GlyGen
75	O-linked (GalNAc...) threonine	11769972 1556128 23584533 25813380	G57321FI	UniProt GlyGen
77		23584533	G57321FI	GlyGen
78		23584533 25813380	G57321FI	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 31 in total

1

2

3

4

Next ›

Last »
Pathway Name	Organism
Cargo recognition for clathrin-mediated endocytosis	Homo sapiens
Clathrin-mediated endocytosis	Homo sapiens
Constitutive Signaling by Aberrant PI3K in Cancer	Homo sapiens
Downregulation of ERBB2 signaling	Homo sapiens
EGFR Transactivation by Gastrin	Homo sapiens
EGFR downregulation	Homo sapiens
EGFR interacts with phospholipase C-gamma	Homo sapiens
ERBB2 Activates PTK6 Signaling	Homo sapiens
ERBB2 Regulates Cell Motility	Homo sapiens
Estrogen-dependent nuclear events downstream of ESR-membrane signaling	Homo sapiens

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:8677	perinatal necrotizing enterocolitis	Alliance of Genome Resources
DOID:0050851	glomerulosclerosis	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements