GlyCosmos Portal

Submissions

Lysophosphatidic acid receptor 4

Summary

UniProt ID: Q99677
Gene Symbol: LPAR4 GPR23 LPA4 P2RY9
Gene ID: 2846
Organism: Homo sapiens (human)

External Links

GlyGen

Q99677

PubChem

Q99677

SwissLipids

SLP:000001577

The Human Metabolome Database

HMDBP07311

Re-Glyco

Q99677

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipid-binding Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

Displaying **all 5** entries
GO Term	Evidence Code	Reference
plasma membrane	TAS	Reactome Reactome Reactome Reactome
plasma membrane	IDA	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF
nuclear body

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body

intracellular organelle [inference]

intracellular membraneless organelle [inference]

nuclear body

Displaying **all 3** entries
GO Term	Evidence Code	Reference
lysophosphatidic acid binding	IEA	GO_REF
lysophosphatidic acid receptor activity	IBA	GO_REF
lysophosphatidic acid receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

lipid binding [inference]

phospholipid binding [inference]

lysophosphatidic acid binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

lysophosphatidic acid binding

carbohydrate derivative binding [inference]

lysophosphatidic acid binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

bioactive lipid receptor activity [inference]

lysophosphatidic acid receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	Source
15	N-linked (GlcNAc...) asparagine		UniProt GlyGen
24	N-linked (GlcNAc...) asparagine		UniProt GlyGen
28	N-linked (GlcNAc...) asparagine		UniProt GlyGen
183	N-linked (GlcNAc...) asparagine	16335952	UniProt GlyGen