GlyCosmos Portal

Submissions

Replication factor C subunit 4

Summary

UniProt ID: Q99J62
Gene Symbol: Rfc4
Gene ID: 106344
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q99J62
PubChem: Q99J62
The O-GlcNAc Database: Q99J62
RaftProt: Q99J62
O-GlcNAcAtlas: Q99J62
Re-Glyco: Q99J62

Annotation

Keyword: ATP-binding Acetylation DNA replication Direct protein sequencing Nucleus Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
DNA-templated DNA replication	ISO	GO_REF
DNA-templated DNA replication	IBA	GO_REF
DNA-templated DNA replication	IEA	GO_REF
DNA repair	IBA	GO_REF
positive regulation of DNA-directed DNA polymerase activity	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA replication [inference]

DNA-templated DNA replication

DNA repair

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA replication [inference]

DNA-templated DNA replication

DNA repair

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of macromolecule biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of DNA metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of DNA metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of DNA-directed DNA polymerase activity

regulation of transferase activity [inference]

positive regulation of DNA-directed DNA polymerase activity

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF
nucleoplasm	ISO	GO_REF
nucleoplasm	IEA	GO_REF
DNA replication factor C complex	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

DNA replication factor C complex

nuclear protein-containing complex [inference]

Ctf18 RFC-like complex

catalytic complex [inference]

Elg1 RFC-like complex

cellular anatomical structure [inference]

nucleoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
DNA binding	IEA	GO_REF
DNA clamp loader activity	ISS	GO_REF
DNA clamp loader activity	ISO	GO_REF
DNA clamp loader activity	IBA	GO_REF
DNA clamp loader activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

ATP hydrolysis activity

isomerase activity [inference]

macromolecular conformation isomerase activity [inference]

nucleic acid conformation isomerase activity [inference]

helicase activity [inference]

DNA helicase activity [inference]

single-stranded DNA helicase activity

catalytic activity, acting on a nucleic acid [inference]

helicase activity [inference]

DNA helicase activity [inference]

single-stranded DNA helicase activity

catalytic activity, acting on DNA [inference]

ATP-dependent activity, acting on DNA [inference]

DNA helicase activity [inference]

single-stranded DNA helicase activity

DNA clamp loader activity

binding [inference]

nucleic acid binding [inference]

DNA binding

protein binding [inference]

enzyme binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

ATP-dependent activity [inference]

helicase activity [inference]

DNA helicase activity [inference]

single-stranded DNA helicase activity

ATP-dependent activity, acting on DNA [inference]

DNA helicase activity [inference]

single-stranded DNA helicase activity

DNA clamp loader activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQAFLKGTSVSAKAQLTKDRGTPATAGSSGETKKVKPVPWVEKYRPKCVDEVAFQDEVVAVLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEIAYLVKISEGDLRKAITFLQSATRLTGGKEVSEDVITDIAGVIPAATIDGIFTACHSGSFDKLEAVVKNLIDEGHAATQLVNQLHDAIIENENLSDKHKSIITEKLAEVDKCLADGADEHLQLMSLCATVMQQLTQNC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
29		30059200	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 19 in total

1

2

Next ›

Last »
Pathway Name	Organism
Activation of ATR in response to replication stress	Mus musculus
Dual Incision in GG-NER	Mus musculus
Dual incision in TC-NER	Mus musculus
G2/M DNA damage checkpoint	Mus musculus
Gap-filling DNA repair synthesis and ligation in GG-NER	Mus musculus
Gap-filling DNA repair synthesis and ligation in TC-NER	Mus musculus
HDR through Homologous Recombination (HRR)	Mus musculus
HDR through Single Strand Annealing (SSA)	Mus musculus
PCNA-Dependent Long Patch Base Excision Repair	Mus musculus
Polymerase switching	Mus musculus