GlyCosmos Portal

Submissions

Phospholipid phosphatase 3

Summary

UniProt ID: Q99JY8
Gene Symbol: Plpp3 Lpp3 Ppap2b
Gene ID: 67916
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0007212

GlyConnect

Phospholipid phosphatase 3

GlyGen

Q99JY8

PubChem

Q99JY8

RaftProt

Q99JY8

Re-Glyco

Q99JY8

Annotation

Keyword: Cell membrane Developmental protein Direct protein sequencing Endoplasmic reticulum Glycoprotein Golgi apparatus Hydrolase Lipid metabolism Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 47 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
blood vessel development	IMP	PMID
gastrulation with mouth forming second	IMP	PMID
phospholipid metabolic process	ISS	GO_REF
phospholipid metabolic process	ISO	GO_REF
phospholipid metabolic process	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

cell adhesion mediated by integrin [inference]

cell-cell adhesion mediated by integrin

cell-cell adhesion

cell-cell adhesion mediated by integrin

signal transduction

cell surface receptor signaling pathway [inference]

integrin-mediated signaling pathway

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process

dephosphorylation [inference]

phospholipid dephosphorylation

organophosphate metabolic process [inference]

phospholipid metabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process

sphingolipid metabolic process [inference]

ceramide metabolic process

sphingoid metabolic process [inference]

sphingosine metabolic process

lipid modification [inference]

phospholipid dephosphorylation

small molecule metabolic process [inference]

alcohol metabolic process [inference]

polyol metabolic process [inference]

diol metabolic process [inference]

sphingosine metabolic process

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum

cellular developmental process [inference]

cell differentiation [inference]

glial cell differentiation [inference]

astrocyte differentiation [inference]

Bergmann glial cell differentiation

developmental process [inference]

anatomical structure morphogenesis [inference]

embryonic morphogenesis [inference]

gastrulation [inference]

gastrulation with mouth forming second

anatomical structure development [inference]

blood vessel development

cellular developmental process [inference]

cell differentiation [inference]

glial cell differentiation [inference]

astrocyte differentiation [inference]

Bergmann glial cell differentiation

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of endothelial cell-matrix adhesion

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

integrin-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of endothelial cell-matrix adhesion

regulation of endothelial cell-matrix adhesion [inference]

positive regulation of endothelial cell-matrix adhesion

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of endothelial cell-matrix adhesion

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

regulation of homotypic cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of endothelial cell-matrix adhesion

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of endothelial cell-matrix adhesion

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 34 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	ISS	GO_REF
Golgi membrane	ISO	GO_REF
Golgi membrane	IEA	GO_REF
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	ISO	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

organelle membrane [inference]

endoplasmic reticulum membrane

bounding membrane of organelle [inference]

plasma membrane region [inference]

basolateral plasma membrane

membrane microdomain [inference]

membrane raft

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

adherens junction

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

trans-Golgi network

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

endoplasmic reticulum exit site

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
integrin binding	ISO	GO_REF
integrin binding	IDA	PMID
integrin binding	IEA	GO_REF
phosphatidate phosphatase activity	ISS	GO_REF
phosphatidate phosphatase activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

phosphoric ester hydrolase activity [inference]

phosphatase activity [inference]

lipid phosphatase activity

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

cell adhesion molecule binding [inference]

integrin binding

delta-catenin binding

protein-containing complex binding [inference]

integrin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPVDIIDRNNHHNMV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites