GlyCosmos Portal

Submissions

Hepatocyte growth factor-regulated tyrosine kinase substrate

Summary

UniProt ID: Q99LI8
Gene Symbol: Hgs Hrs
Gene ID: 15239
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q99LI8
PubChem: Q99LI8
The O-GlcNAc Database: Q99LI8
O-GlcNAcAtlas: Q99LI8
Re-Glyco: Q99LI8

Annotation

Keyword: Acetylation Cytoplasm Endosome Membrane Phosphoprotein Protein transport Reference proteome Ubl conjugation Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
protein targeting to lysosome	ISO	GO_REF
protein targeting to lysosome	IEA	GO_REF
endosome to lysosome transport	ISO	GO_REF
membrane invagination	ISO	GO_REF
membrane invagination	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

intercellular transport [inference]

endosome to lysosome transport

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

endosome to lysosome transport

endosomal transport [inference]

endocytic recycling

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

lysosomal transport [inference]

endosomal transport [inference]

endocytic recycling

localization within membrane [inference]

protein localization to membrane

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

cellular component organization or biogenesis [inference]

cellular component organization [inference]

membrane organization [inference]

membrane invagination

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

protein localization to organelle [inference]

protein localization to vacuole [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

protein localization to lysosome [inference]

protein targeting to lysosome

protein localization to membrane

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

endosome to lysosome transport

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

endosome to lysosome transport

endosomal transport [inference]

endocytic recycling

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

lysosomal transport [inference]

endosomal transport [inference]

endocytic recycling

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

establishment of protein localization [inference]

protein targeting [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

establishment of protein localization to organelle [inference]

establishment of protein localization to vacuole [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

lysosomal transport [inference]

endosomal transport [inference]

endocytic recycling

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

lysosomal transport [inference]

endosomal transport [inference]

endocytic recycling

localization within membrane [inference]

protein localization to membrane

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

regulation of platelet-derived growth factor receptor signaling pathway [inference]

negative regulation of platelet-derived growth factor receptor signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

negative regulation of vascular endothelial growth factor receptor signaling pathway

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cellular component biogenesis [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor receptor signaling pathway

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

regulation of platelet-derived growth factor receptor signaling pathway [inference]

negative regulation of platelet-derived growth factor receptor signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

negative regulation of vascular endothelial growth factor receptor signaling pathway

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor receptor signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

negative regulation of vascular endothelial growth factor receptor signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor receptor signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

regulation of platelet-derived growth factor receptor signaling pathway [inference]

negative regulation of platelet-derived growth factor receptor signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

negative regulation of vascular endothelial growth factor receptor signaling pathway

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of exosomal secretion

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cellular component biogenesis [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of receptor signaling pathway via STAT [inference]

negative regulation of receptor signaling pathway via JAK-STAT

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
cytoplasm	IDA	PMID
cytoplasm	IEA	GO_REF GO_REF
lysosome	ISO	GO_REF
endosome	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

ESCRT complex [inference]

ESCRT-0 complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

early endosome membrane

late endosome membrane [inference]

multivesicular body membrane

bounding membrane of organelle [inference]

endosome membrane [inference]

early endosome membrane

late endosome membrane [inference]

multivesicular body membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

secretory vesicle [inference]

secretory granule

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

secretory vesicle [inference]

secretory granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

secretory vesicle [inference]

secretory granule

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
zinc ion binding
protein domain specific binding	ISO	GO_REF
protein domain specific binding	IEA	GO_REF
phosphatidylinositol binding	IEA	GO_REF
identical protein binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

ubiquitin-like protein ligase binding

protein domain specific binding

ubiquitin-like protein binding [inference]

ubiquitin binding

identical protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

phosphatidylinositol binding

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

ubiquitin-like protein reader activity [inference]

ubiquitin-modified protein reader activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKASSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKTTYTAHPKAEPTPLASSAPPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHTAPNSMAEAPLPETDSQPITPCSGPFSEYQNGESEESHEQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINTMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPATFSPAGSVEGSPMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPTGAPGAQAAPQAQAGPTTSPAYSSYQPTPTPGYQSVASQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTALPGQDASLPAQQPYIPGQQPLYQQMAPSTGPPQQQPPVAQPAPTQGPPAQGSEAQLISFD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 12 in total

1

2

Next ›

Last »
Position	PubMed ID	GlyTouCan ID	Source
177	36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
299	36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
300	36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
309	36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
310	36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
313		G37692EO	GlyGen
347			GlyGen
385			GlyGen
653			GlyGen
664			GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 9** entries
Pathway Name	Organism
Cargo recognition for clathrin-mediated endocytosis	Mus musculus
Clathrin-mediated endocytosis	Mus musculus
EGFR downregulation	Mus musculus
Endosomal Sorting Complex Required For Transport (ESCRT)	Mus musculus
Lysosome Vesicle Biogenesis	Mus musculus
Negative regulation of MET activity	Mus musculus
RHOBTB3 ATPase cycle	Mus musculus
RHOU GTPase cycle	Mus musculus
Ub-specific processing proteases	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements