GlyCosmos Portal

Submissions

Sodium/potassium/calcium exchanger 3

Summary

UniProt ID: Q99PD7
Gene Symbol: Nckx3 Slc24a3
Gene ID: 94249
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0007267
PubChem: Q99PD7
Re-Glyco: Q99PD7

Annotation

Keyword: Antiport Calcium transport Cell membrane Glycoprotein Phosphoprotein Potassium transport Reference proteome Repeat Signal Sodium transport Symport Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
monoatomic cation transport	ISO	GO_REF
intracellular calcium ion homeostasis	ISO	GO_REF
intracellular calcium ion homeostasis	TAS	PMID
intracellular calcium ion homeostasis	IMP	PMID
intracellular calcium ion homeostasis	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

developmental process [inference]

anatomical structure development [inference]

tissue development [inference]

biomineral tissue development [inference]

bone mineralization

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport

metal ion transport [inference]

potassium ion transport [inference]

potassium ion transmembrane transport

sodium ion transport [inference]

sodium ion transmembrane transport

calcium ion transport [inference]

calcium ion transmembrane transport

monoatomic cation transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	TAS	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell periphery

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
calcium channel activity	IBA	GO_REF
calcium, potassium:sodium antiporter activity	ISS	PMID GO_REF
calcium, potassium:sodium antiporter activity	ISO	GO_REF GO_REF
calcium, potassium:sodium antiporter activity	IDA	PMID
calcium, potassium:sodium antiporter activity	IBA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

calcium channel activity

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity [inference]

calcium channel activity

metal ion transmembrane transporter activity [inference]

potassium ion transmembrane transporter activity [inference]

solute:potassium antiporter activity [inference]

calcium, potassium:sodium antiporter activity

sodium ion transmembrane transporter activity [inference]

calcium:sodium antiporter activity [inference]

calcium, potassium:sodium antiporter activity

calcium ion transmembrane transporter activity [inference]

calcium channel activity

calcium:monoatomic cation antiporter activity [inference]

calcium:sodium antiporter activity [inference]

calcium, potassium:sodium antiporter activity

metal cation:monoatomic cation antiporter activity [inference]

calcium:monoatomic cation antiporter activity [inference]

calcium:sodium antiporter activity [inference]

calcium, potassium:sodium antiporter activity

solute:potassium antiporter activity [inference]

calcium, potassium:sodium antiporter activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

calcium channel activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

symporter activity

antiporter activity [inference]

metal cation:monoatomic cation antiporter activity [inference]

calcium:monoatomic cation antiporter activity [inference]

calcium:sodium antiporter activity [inference]

calcium, potassium:sodium antiporter activity

solute:potassium antiporter activity [inference]

calcium, potassium:sodium antiporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPPPGDQDCARRRSRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLIGEDRKWMVGRKLMQVNDTLTSEDAGLQSSKNCTEPALHEFPRDIFSNEDRRQGAVVLHVLCAMYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVVALIVFIYDEKVSWWESLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLINSRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDIVAETDNETENENEDNENNENDEEEEEDEDDDEGPYTPFDPPSGKLETVKWAFTWPLSFVLYFTVPNCNKPHWEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVHLNKWQLDKKLGCGCLFLYGVFLCFSIMTEFNVFTFVNLPMCGD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites