GlyCosmos Portal

Submissions

Neurotrimin

Summary

UniProt ID: Q99PJ0
Gene Symbol: Hnt Nt Ntm
Gene ID: 235106
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0007270

GlyConnect

Neurotrimin

GlyGen

Q99PJ0

PubChem

Q99PJ0

RaftProt

Q99PJ0

O-GlcNAcAtlas

Q99PJ0

Re-Glyco

Q99PJ0

Annotation

Keyword: Cell adhesion Cell membrane Disulfide bond GPI-anchor Immunoglobulin domain Reference proteome Repeat Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
cell adhesion
positive regulation of neuron projection development	ISO	GO_REF
negative regulation of neuron projection development	ISO	GO_REF
negative regulation of glial cell proliferation	ISO	GO_REF
positive regulation of Schwann cell migration	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration [inference]

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

regulation of glial cell migration [inference]

regulation of Schwann cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of glial cell proliferation

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of cellular process [inference]

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of glial cell proliferation

regulation of glial cell proliferation [inference]

negative regulation of glial cell proliferation

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of glial cell proliferation

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration [inference]

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

regulation of glial cell migration [inference]

regulation of Schwann cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
cell surface	ISO	GO_REF
axon	ISO	GO_REF
perinuclear region of cytoplasm	ISO	GO_REF
presynaptic active zone membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane region [inference]

synaptic membrane [inference]

presynaptic active zone membrane

postsynaptic specialization membrane [inference]

postsynaptic density membrane

cell junction [inference]

synapse [inference]

excitatory synapse

neuron to neuron synapse [inference]

hippocampal mossy fiber to CA3 synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

Displaying 1 entry
GO Term	Evidence Code	Reference
identical protein binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVKVENRPFLSKLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVNNGTSRRAGCIWLLPLLVLHLLLKF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 8** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
44	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt GlyGen
70	N-linked (GlcNAc...) asparagine			UniProt GlyGen
152	N-linked (GlcNAc...) asparagine			UniProt GlyGen
246			G49108TO	GlyGen
284	N-linked (GlcNAc...) asparagine		G80920RR	GlycoProtDB UniProt GlyGen
292	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt GlyGen
305	N-linked (GlcNAc...) asparagine	30899004	G09406IK G50045TK G01937VC G33609NS G25637MV G06110VR	UniProt GlyGen GlyConnect
321	N-linked (GlcNAc...) asparagine; alternate		G90659AW	UniProt GlyGen