GlyCosmos Portal

Submissions

Thiamine transporter 2

Summary

UniProt ID: Q99PL8
Gene Symbol: Slc19a3
Gene ID: 80721
Organism: Mus musculus (house mouse)

External Links

PubChem: Q99PL8
Re-Glyco: Q99PL8

Annotation

Keyword: Glycoprotein Reference proteome Transmembrane helix Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
thiamine diphosphate biosynthetic process	IDA	PMID
thiamine diphosphate biosynthetic process	IMP	PMID
thiamine transport	ISO	PMID GO_REF
thiamine transport	IDA	PMID
thiamine transport	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

thiamine-containing compound metabolic process [inference]

thiamine diphosphate metabolic process [inference]

thiamine diphosphate biosynthetic process

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

sulfur compound biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

thiamine diphosphate metabolic process [inference]

thiamine diphosphate biosynthetic process

organophosphate metabolic process [inference]

thiamine diphosphate metabolic process [inference]

thiamine diphosphate biosynthetic process

organophosphate biosynthetic process [inference]

thiamine diphosphate biosynthetic process

biosynthetic process [inference]

sulfur compound biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

small molecule biosynthetic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

pyrimidine-containing compound biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

organophosphate biosynthetic process [inference]

thiamine diphosphate biosynthetic process

small molecule metabolic process [inference]

vitamin metabolic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

small molecule biosynthetic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

pyrimidine-containing compound metabolic process [inference]

thiamine-containing compound metabolic process [inference]

thiamine diphosphate metabolic process [inference]

thiamine diphosphate biosynthetic process

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

pyrimidine-containing compound biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

transmembrane transport [inference]

vitamin transmembrane transport [inference]

thiamine transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

localization [inference]

establishment of localization [inference]

transport [inference]

organic cation transport [inference]

thiamine transport

thiamine transmembrane transport

organic hydroxy compound transport [inference]

pyridoxine transport

vitamin transport [inference]

thiamine transport

thiamine transmembrane transport

vitamin B6 transport [inference]

pyridoxine transport

vitamin transmembrane transport [inference]

thiamine transmembrane transport

transmembrane transport [inference]

vitamin transmembrane transport [inference]

thiamine transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

nitrogen compound transport [inference]

thiamine transport

thiamine transmembrane transport

vitamin B6 transport [inference]

pyridoxine transport

azole transmembrane transport [inference]

thiamine transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

sulfur compound transport [inference]

thiamine transport

thiamine transmembrane transport

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane	IC	PMID
plasma membrane	IDA	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
thiamine transmembrane transporter activity	ISO	PMID
thiamine transmembrane transporter activity	IMP	PMID PMID
thiamine transmembrane transporter activity	IBA	GO_REF
thiamine transmembrane transporter activity	IEA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

vitamin transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

azole transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

sulfur compound transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDSSCRTPPSNSWVYPTVILCLFGFFSMFRPSEAFLIPFLSEPSKNLTSPEMTNEILPVWTYSYLATLPPVFVLTDYLRYKPVIMLHVVAFATSYLFLLFGQGVMLMQTAEFFFGVVSATEIAYFAYIYSMVSPEHYQKVSSYCRSITLVAYTAGSVLAQLLVSLTNLPYSSLFYISLACVSVAFFFSLFLPMPKKSMFFHAKSDRDDCPKPLEQCTVPKEAQSNRTHSELFANSKNLEDREMSNPDPENSALRHFAHWFQDLKECYSSKHLVYWSLWWAFATAGYNQILNYVQVLWEHKAPSQDSSIYNGAVEAIATFGGALASFSVGYLKVNWDLLGELGLAVFSAVIAGSLFLMNYSRSIWVCYAGYLLVKSSYSFLITIAVFQIAVNLSLERYALVFGIDTFIALVIQTIMTMIVVDQRGLQLPVTTQFLVYGSYFAVIAGVFLMRSIYILCSAKCRKEVQNLATTRSPNEPHPQEPSNVSTKF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
46	N-linked (GlcNAc...) asparagine			UniProt
358	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Vitamin B1 (thiamin) metabolism	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0050659	biotin-responsive basal ganglia disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements