GlyCosmos Portal

Submissions

ATP synthase F(0) complex subunit g, mitochondrial

Summary

UniProt ID: Q9CPQ8
Gene Symbol: Atp5mg Atp5l
Gene ID: 27425
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9CPQ8
PubChem: Q9CPQ8
RaftProt: Q9CPQ8
O-GlcNAcAtlas: Q9CPQ8
Re-Glyco: Q9CPQ8

Annotation

Keyword: ATP synthesis Acetylation CF(0) Direct protein sequencing Mitochondrion inner membrane Reference proteome

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
proton motive force-driven ATP synthesis	ISO	PMID
proton motive force-driven ATP synthesis	IBA	GO_REF
proton motive force-driven ATP synthesis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrion	IBA	GO_REF
mitochondrion	IEA	GO_REF
mitochondrion	HDA	PMID PMID
mitochondrial inner membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

proton-transporting two-sector ATPase complex [inference]

proton-transporting ATP synthase complex

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

cation channel complex [inference]

proton-transporting ATP synthase complex

respiratory chain complex [inference]

proton-transporting ATP synthase complex

catalytic complex [inference]

proton-transporting ATP synthase complex

transporter complex [inference]

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

cation channel complex [inference]

proton-transporting ATP synthase complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying 1 entry
GO Term	Evidence Code	Reference
P-type proton-exporting transporter activity	ISO	PMID

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity [inference]

P-type proton-exporting transporter activity

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type proton-exporting transporter activity

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type proton-exporting transporter activity

active transmembrane transporter activity [inference]

primary active transmembrane transporter activity [inference]

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type proton-exporting transporter activity

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type proton-exporting transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type proton-exporting transporter activity

ATP-dependent activity [inference]

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type proton-exporting transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type proton-exporting transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAKFIRNFAEKAPSMVAAAVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQSVKKIIQSAKTGSFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
23			G49108TO	GlyGen
42				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Cristae formation	Mus musculus
Formation of ATP by chemiosmotic coupling	Mus musculus
Mitochondrial protein degradation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements