GlyCosmos Portal

Submissions

Serine/threonine-protein phosphatase 6 catalytic subunit

Summary

UniProt ID: Q9CQR6
Gene Symbol: Ppp6c
Gene ID: 67857
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9CQR6
PubChem: Q9CQR6
O-GlcNAcAtlas: Q9CQR6
Re-Glyco: Q9CQR6

Annotation

Keyword: Acetylation Cell cycle Cytoplasm Innate immunity Manganese Metal-binding Mitochondrion Protein phosphatase Reference proteome

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
G1/S transition of mitotic cell cycle	IBA	GO_REF
innate immune response
cGAS/STING signaling pathway	ISO	GO_REF
negative regulation of cGAS/STING signaling pathway	ISO	GO_REF
negative regulation of cGAS/STING signaling pathway	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

immune response [inference]

innate immune response

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

cell cycle process [inference]

cell cycle phase transition [inference]

mitotic cell cycle phase transition [inference]

G1/S transition of mitotic cell cycle

cell cycle G1/S phase transition [inference]

G1/S transition of mitotic cell cycle

mitotic cell cycle process [inference]

mitotic cell cycle phase transition [inference]

G1/S transition of mitotic cell cycle

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of pattern recognition receptor signaling pathway [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of pattern recognition receptor signaling pathway [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of intracellular signal transduction [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of pattern recognition receptor signaling pathway [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of pattern recognition receptor signaling pathway [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of intracellular signal transduction [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of pattern recognition receptor signaling pathway [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of pattern recognition receptor signaling pathway [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of pattern recognition receptor signaling pathway [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

cGAS/STING signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of pattern recognition receptor signaling pathway [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

regulation of intracellular signal transduction [inference]

regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of cytoplasmic pattern recognition receptor signaling pathway [inference]

negative regulation of cGAS/STING signaling pathway

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF
mitochondrion	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying **all 5** entries
GO Term	Evidence Code	Reference
protein serine/threonine phosphatase activity	ISS	GO_REF
protein serine/threonine phosphatase activity	ISO	PMID GO_REF GO_REF
protein serine/threonine phosphatase activity	IDA	PMID
protein serine/threonine phosphatase activity	IEA	GO_REF GO_REF GO_REF GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

phosphoric ester hydrolase activity [inference]

phosphatase activity [inference]

phosphoprotein phosphatase activity [inference]

protein serine/threonine phosphatase activity

catalytic activity, acting on a protein [inference]

phosphoprotein phosphatase activity [inference]

protein serine/threonine phosphatase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites