GlyCosmos Portal

Submissions

GPI-anchor transamidase

Summary

UniProt ID: Q9CXY9
Gene Symbol: Pigk
Gene ID: 329777
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9CXY9
PubChem: Q9CXY9
The O-GlcNAc Database: Q9CXY9
RaftProt: Q9CXY9
O-GlcNAcAtlas: Q9CXY9
Re-Glyco: Q9CXY9

Annotation

Keyword: Calcium Disulfide bond Endoplasmic reticulum GPI-anchor biosynthesis Metal-binding Reference proteome Signal Transferase Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
GPI anchor biosynthetic process	IEA	GO_REF
proteolysis	IEA	GO_REF
attachment of GPI anchor to protein	ISS	GO_REF
attachment of GPI anchor to protein	ISO	GO_REF
attachment of GPI anchor to protein	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

protein maturation [inference]

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycerolipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

protein metabolic process [inference]

proteolysis

protein maturation [inference]

carbohydrate derivative metabolic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

Displaying **all 4** entries
GO Term	Evidence Code	Reference
GPI-anchor transamidase complex	ISS	GO_REF
GPI-anchor transamidase complex	ISO	GO_REF
GPI-anchor transamidase complex	IBA	GO_REF
GPI-anchor transamidase complex	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

GPI-anchor transamidase complex

endoplasmic reticulum protein-containing complex [inference]

GPI-anchor transamidase complex

catalytic complex [inference]

peptidase complex [inference]

endopeptidase complex [inference]

caspase complex [inference]

GPI-anchor transamidase complex

transferase complex [inference]

GPI-anchor transamidase complex

Displaying **all 5** entries
GO Term	Evidence Code	Reference
GPI-anchor transamidase activity	ISS	GO_REF
GPI-anchor transamidase activity	ISO	GO_REF
GPI-anchor transamidase activity	IBA	GO_REF
GPI-anchor transamidase activity	IEA	GO_REF GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring nitrogenous groups [inference]

GPI-anchor transamidase activity

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

cysteine-type endopeptidase activity [inference]

GPI-anchor transamidase activity

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity [inference]

GPI-anchor transamidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

cysteine-type endopeptidase activity [inference]

GPI-anchor transamidase activity

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity [inference]

GPI-anchor transamidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAPCFLTLRVATLAALALLSLGSSAAGHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNARNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRVPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTEKISLQWDSQVVDSSSKEDGTAEERMGPLKYAEQLPVAQIIHQKPKPRDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites