GlyCosmos Portal

Submissions

Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

Summary

UniProt ID: Q9CZB0
Gene Symbol: Sdhc
Gene ID: 66052
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9CZB0
PubChem: Q9CZB0
Re-Glyco: Q9CZB0

Annotation

Keyword: Electron transport Heme Mitochondrion inner membrane Reference proteome Transit peptide Transmembrane helix Tricarboxylic acid cycle

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
tricarboxylic acid cycle	NAS	PMID
tricarboxylic acid cycle	IMP	PMID
tricarboxylic acid cycle	IEA	GO_REF GO_REF GO_REF
mitochondrial electron transport, succinate to ubiquinone	NAS	PMID
mitochondrial electron transport, succinate to ubiquinone	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

cellular respiration [inference]

aerobic respiration [inference]

aerobic electron transport chain [inference]

mitochondrial electron transport, succinate to ubiquinone

electron transport chain [inference]

respiratory electron transport chain [inference]

aerobic electron transport chain [inference]

mitochondrial electron transport, succinate to ubiquinone

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

primary metabolic process [inference]

tricarboxylic acid cycle

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	IDA	PMID PMID
mitochondrion	HDA	PMID PMID
mitochondrial inner membrane	ISS	GO_REF
mitochondrial inner membrane	ISO	GO_REF
mitochondrial inner membrane	NAS	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

respiratory chain complex II (succinate dehydrogenase)

respiratory chain complex [inference]

respiratory chain complex II (succinate dehydrogenase)

catalytic complex [inference]

oxidoreductase complex [inference]

respiratory chain complex II (succinate dehydrogenase)

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying **all 3** entries
GO Term	Evidence Code	Reference
electron transfer activity	IEA	GO_REF
heme binding	ISS	GO_REF
metal ion binding

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

tetrapyrrole binding [inference]

heme binding

electron transfer activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAFLLRHVSRHCLRAHLNAQLCIRNAAPLGTTAKEEMERFWKKNTSSNRPLSPHLTIYKWSLPMALSVCHRGSGIALSGGVSLFGLSALLLPGNFESYLMFVKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVWLSGVAVVVLAVLSSGGLAAL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
45			G02815KT	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Citric acid cycle (TCA cycle)	Mus musculus
Maturation of TCA enzymes and regulation of TCA cycle	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:3652	Leigh disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements