GlyCosmos Portal

Submissions

mRNA cap guanine-N(7) methyltransferase

Summary

UniProt ID: Q9D0L8
Gene Symbol: Kiaa0398 Rnmt
Gene ID: 67897
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9D0L8
PubChem: Q9D0L8
Re-Glyco: Q9D0L8

Annotation

Keyword: Alternative splicing Methyltransferase Nucleus Phosphoprotein RNA-binding Reference proteome S-adenosyl-L-methionine mRNA capping

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
7-methylguanosine mRNA capping	ISS	GO_REF
7-methylguanosine mRNA capping	ISO	GO_REF GO_REF
7-methylguanosine mRNA capping	IBA	GO_REF
7-methylguanosine mRNA capping	IEA	GO_REF GO_REF
cellular response to leukemia inhibitory factor	IEP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

7-methylguanosine mRNA capping

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

7-methylguanosine mRNA capping

RNA processing [inference]

RNA 5'-end processing [inference]

RNA capping [inference]

7-methylguanosine RNA capping [inference]

7-methylguanosine mRNA capping

mRNA processing [inference]

7-methylguanosine mRNA capping

response to stimulus [inference]

response to chemical [inference]

response to peptide [inference]

response to cytokine [inference]

cellular response to cytokine stimulus [inference]

cellular response to leukemia inhibitory factor

response to leukemia inhibitory factor [inference]

cellular response to leukemia inhibitory factor

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
fibrillar center	ISO	GO_REF
fibrillar center	IEA	GO_REF
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

nuclear protein-containing complex [inference]

mRNA capping enzyme complex

catalytic complex [inference]

transferase complex [inference]

methyltransferase complex [inference]

mRNA cap methyltransferase RNMT:RAMAC complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA binding	ISS	GO_REF
RNA binding	ISO	GO_REF
RNA binding	IEA	GO_REF
mRNA 5'-cap (guanine-N7-)-methyltransferase activity	ISS	GO_REF
mRNA 5'-cap (guanine-N7-)-methyltransferase activity	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring one-carbon groups [inference]

methyltransferase activity [inference]

N-methyltransferase activity [inference]

mRNA 5'-cap (guanine-N7-)-methyltransferase activity

RNA methyltransferase activity [inference]

mRNA methyltransferase activity [inference]

mRNA 5'-cap (guanine-N7-)-methyltransferase activity

S-adenosylmethionine-dependent methyltransferase activity [inference]

mRNA methyltransferase activity [inference]

mRNA 5'-cap (guanine-N7-)-methyltransferase activity

catalytic activity, acting on a nucleic acid [inference]

catalytic activity, acting on RNA [inference]

RNA methyltransferase activity [inference]

mRNA methyltransferase activity [inference]

mRNA 5'-cap (guanine-N7-)-methyltransferase activity

binding [inference]

nucleic acid binding [inference]

RNA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEGSAKASVASDPESPPGGNEPAAASGQRLPENTPPCQQVDQPKMQKEFGEDLVEQNSSYVQDSPSKKRKLDVEIILEEKHSEDDGGSAKRSKLERGDVSEDEPSLGRLNQTKRKLQPQDDEVPQKLQKLEEGHSSAVAAHYNELQEVGLAKRSQSRIFYLRNFNNWIKSILIGEILEKVRQRKTRDITVLDLGCGKGGDLLKWRKGRISRLVCADIADISMKQCQQRYEDMRCRRDNEHIFSAEFITADCSKELLVEKFRDPEMYFDVCSCQFACHYSFESQVQADTMLRNACGRLNPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGNYPLFGCKYDFNLEGVVDVPEFLVYFPLLTEMAKKYNMKLIYKKTFLEFYEEKIKNNENKMLLKRMQALEQYPAHENSKLASEKVGDYTHAAEYLKKSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites