GlyCosmos Portal

Submissions

Cytochrome c1, heme protein, mitochondrial

Summary

UniProt ID: Q9D0M3
Gene Symbol: Cyc1
Gene ID: 66445
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9D0M3
PubChem: Q9D0M3
RaftProt: Q9D0M3
Re-Glyco: Q9D0M3

Annotation

Keyword: 3D-structure Alternative splicing Direct protein sequencing Heme Mitochondrion inner membrane Reference proteome Respiratory chain Transit peptide Translocase Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
mitochondrial electron transport, ubiquinol to cytochrome c	NAS	PMID
mitochondrial electron transport, ubiquinol to cytochrome c	IBA	GO_REF
response to glucagon	ISO	GO_REF
response to glucagon	IEA	GO_REF
cellular respiration	NAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

cellular respiration

aerobic respiration [inference]

aerobic electron transport chain [inference]

mitochondrial electron transport, ubiquinol to cytochrome c

electron transport chain [inference]

respiratory electron transport chain [inference]

aerobic electron transport chain [inference]

mitochondrial electron transport, ubiquinol to cytochrome c

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone [inference]

response to glucagon

response to chemical [inference]

response to hormone [inference]

response to peptide hormone [inference]

response to glucagon

response to nitrogen compound [inference]

response to peptide hormone [inference]

response to glucagon

response to oxygen-containing compound [inference]

response to peptide hormone [inference]

response to glucagon

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	IDA	PMID
mitochondrion	HDA	PMID PMID
mitochondrial inner membrane	ISO	GO_REF
mitochondrial inner membrane	IDA	PMID PMID
mitochondrial inner membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

transmembrane transporter complex [inference]

respiratory chain complex III

respiratory chain complex [inference]

respiratory chain complex III

catalytic complex [inference]

cytochrome complex [inference]

respiratory chain complex III

transporter complex [inference]

transmembrane transporter complex [inference]

respiratory chain complex III

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying **all 4** entries
GO Term	Evidence Code	Reference
quinol-cytochrome-c reductase activity	ISS	GO_REF
quinol-cytochrome-c reductase activity	IEA	GO_REF GO_REF
heme binding	IEA	GO_REF
metal ion binding

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity [inference]

quinol-cytochrome-c reductase activity

active monoatomic ion transmembrane transporter activity [inference]

quinol-cytochrome-c reductase activity

active transmembrane transporter activity [inference]

primary active transmembrane transporter activity [inference]

oxidoreduction-driven active transmembrane transporter activity [inference]

quinol-cytochrome-c reductase activity

active monoatomic ion transmembrane transporter activity [inference]

quinol-cytochrome-c reductase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

tetrapyrrole binding [inference]

heme binding

electron transfer activity [inference]

quinol-cytochrome-c reductase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAVSLSSKSGPSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
259				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Complex III assembly	Mus musculus
Respiratory electron transport	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements