GlyCosmos Portal

Submissions

Ras-related protein Rab-1B

Summary

UniProt ID: Q9D1G1
Gene Symbol: Rab1b
Gene ID: 76308
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9D1G1
PubChem: Q9D1G1
RaftProt: Q9D1G1
Re-Glyco: Q9D1G1

Annotation

Keyword: Acetylation Autophagy Cytoplasm Direct protein sequencing GTP-binding Hydrolase Magnesium Membrane Metal-binding Methylation Phosphoprotein Prenylation Protein transport Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
autophagosome assembly	IBA	GO_REF
intracellular protein transport
endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	GO_REF
Golgi organization	ISS	GO_REF
Golgi organization	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

intercellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

cellular localization [inference]

intracellular transport [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

Golgi organization

vacuole organization [inference]

autophagosome organization [inference]

autophagosome assembly

organelle assembly [inference]

autophagosome assembly

cellular component assembly [inference]

organelle assembly [inference]

autophagosome assembly

viral process [inference]

virion assembly

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

protein transport [inference]

intracellular protein transport

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

intracellular transport [inference]

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport

establishment of localization in cell [inference]

intracellular transport [inference]

cellular localization [inference]

intracellular transport [inference]

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of glycoprotein metabolic process

regulation of cellular process [inference]

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of glycoprotein metabolic process

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of glycoprotein metabolic process

regulation of protein metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of glycoprotein metabolic process

regulation of glycoprotein metabolic process [inference]

positive regulation of glycoprotein metabolic process

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of glycoprotein metabolic process

regulation of glycoprotein metabolic process [inference]

positive regulation of glycoprotein metabolic process

regulation of cellular component biogenesis [inference]

regulation of organelle assembly [inference]

regulation of autophagosome assembly

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of glycoprotein metabolic process

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of vacuole organization [inference]

regulation of autophagosome assembly

regulation of organelle assembly [inference]

regulation of autophagosome assembly

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	HDA	PMID
endoplasmic reticulum-Golgi intermediate compartment	IDA	PMID
Golgi apparatus	ISO	GO_REF
Golgi apparatus	IEA	GO_REF
endomembrane system

GO Hierarchy

cellular component

cellular anatomical structure [inference]

endomembrane system

membrane [inference]

phagophore assembly site membrane

cell junction [inference]

synapse

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

perinuclear region of cytoplasm

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	ISS	GO_REF
GTPase activity	ISO	GO_REF
GTPase activity	IEA	GO_REF
G protein activity	ISS	GO_REF
G protein activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

G protein activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

molecular function regulator activity [inference]

G protein activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
133			G72787SB	GlyGen
154			G47555ZB	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
COPI-dependent Golgi-to-ER retrograde traffic	Mus musculus
COPI-mediated anterograde transport	Mus musculus
COPII-mediated vesicle transport	Mus musculus
Golgi Cisternae Pericentriolar Stack Reorganization	Mus musculus
RAB GEFs exchange GTP for GDP on RABs	Mus musculus
RAB geranylgeranylation	Mus musculus