GlyCosmos Portal

Submissions

Pre-mRNA-splicing factor SPF27

Summary

UniProt ID

Q9D287

Gene Symbol

Bcas2
Dam1

Gene ID

[68183]

Organism

Mus musculus (house mouse)

External Links

GlyGen: Q9D287
PubChem: Q9D287
Re-Glyco: Q9D287

Annotation

Keyword: Acetylation Coiled coil Nucleus Phosphoprotein Reference proteome Spliceosome

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
alternative mRNA splicing, via spliceosome	IMP	PMID
mRNA splicing, via spliceosome	ISS	GO_REF
mRNA splicing, via spliceosome	ISO	GO_REF
mRNA splicing, via spliceosome	NAS	PMID
mRNA splicing, via spliceosome	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule cytoskeleton organization [inference]

spindle organization [inference]

spindle assembly

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

protein metabolic process [inference]

protein catabolic process

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

alternative mRNA splicing, via spliceosome

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

alternative mRNA splicing, via spliceosome

RNA processing [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

alternative mRNA splicing, via spliceosome

RNA splicing [inference]

RNA splicing, via transesterification reactions [inference]

RNA splicing, via transesterification reactions with bulged adenosine as nucleophile [inference]

mRNA splicing, via spliceosome

alternative mRNA splicing, via spliceosome

protein metabolic process [inference]

protein catabolic process

cell cycle process [inference]

spindle organization [inference]

spindle assembly

cellular process involved in reproduction in multicellular organism [inference]

germ cell development [inference]

cellular developmental process [inference]

cell development [inference]

germ cell development [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization [inference]

spindle organization [inference]

spindle assembly

organelle assembly [inference]

membraneless organelle assembly [inference]

spindle assembly

cellular component assembly [inference]

organelle assembly [inference]

membraneless organelle assembly [inference]

spindle assembly

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

dendrite morphogenesis

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

dendrite development

neuron projection organization [inference]

dendritic spine organization

postsynapse organization [inference]

dendritic spine organization

reproductive process [inference]

developmental process involved in reproduction [inference]

germ cell development [inference]

multicellular organismal reproductive process [inference]

gamete generation [inference]

female gamete generation [inference]

oogenesis

cellular process involved in reproduction in multicellular organism [inference]

germ cell development [inference]

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory

behavior [inference]

learning or memory

developmental process [inference]

developmental process involved in reproduction [inference]

germ cell development [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

dendrite morphogenesis

anatomical structure development [inference]

cell development [inference]

germ cell development [inference]

cellular developmental process [inference]

cell development [inference]

germ cell development [inference]

Displaying entries **1 - 5** of 22 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
Prp19 complex	ISS	GO_REF
Prp19 complex	ISO	GO_REF
Prp19 complex	IMP	PMID
Prp19 complex	IBA	GO_REF
Prp19 complex	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

Prp19 complex

nuclear protein-containing complex [inference]

DNA replication factor A complex

spliceosomal complex

U2-type spliceosomal complex [inference]

U2-type catalytic step 2 spliceosome

catalytic step 2 spliceosome

U2-type catalytic step 2 spliceosome

catalytic complex [inference]

catalytic step 2 spliceosome

U2-type catalytic step 2 spliceosome

ribonucleoprotein complex [inference]

spliceosomal complex

U2-type spliceosomal complex [inference]

U2-type catalytic step 2 spliceosome

catalytic step 2 spliceosome

U2-type catalytic step 2 spliceosome

cellular anatomical structure [inference]

microtubule organizing center [inference]

centrosome

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nucleolus

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites