GlyCosmos Portal

Submissions

Mitochondrial uncoupling protein 4

Summary

UniProt ID: Q9D6D0
Gene Symbol: Slc25a27 UCP4
Gene ID: 74011
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9D6D0
Re-Glyco: Q9D6D0

Annotation

Keyword: Cell projection Mitochondrion inner membrane Reference proteome Repeat Transmembrane helix Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of cell population proliferation	ISO	GO_REF
positive regulation of cell population proliferation	IEA	GO_REF
response to cold	IBA	GO_REF
negative regulation of mitochondrial membrane potential	ISO	GO_REF
negative regulation of mitochondrial membrane potential	IEA	GO_REF

GO Hierarchy

biological process

developmental process [inference]

anatomical structure development [inference]

inner ear development

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

mitochondrial calcium ion homeostasis [inference]

negative regulation of mitochondrial calcium ion concentration

intracellular triglyceride homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

mitochondrial calcium ion homeostasis [inference]

negative regulation of mitochondrial calcium ion concentration

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

mitochondrial calcium ion homeostasis [inference]

negative regulation of mitochondrial calcium ion concentration

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis [inference]

mitochondrial calcium ion homeostasis [inference]

negative regulation of mitochondrial calcium ion concentration

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

mitochondrial calcium ion homeostasis [inference]

negative regulation of mitochondrial calcium ion concentration

intracellular triglyceride homeostasis

lipid homeostasis [inference]

acylglycerol homeostasis [inference]

triglyceride homeostasis [inference]

intracellular triglyceride homeostasis

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis [inference]

mitochondrial calcium ion homeostasis [inference]

negative regulation of mitochondrial calcium ion concentration

response to stimulus [inference]

response to stress [inference]

response to cold

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to cold

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

regulation of D-glucose transmembrane transport [inference]

regulation of D-glucose import across plasma membrane

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process

regulation of cellular process [inference]

regulation of transmembrane transport [inference]

regulation of D-glucose transmembrane transport [inference]

regulation of D-glucose import across plasma membrane

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process

regulation of neuron apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process

regulation of biological quality [inference]

regulation of membrane potential [inference]

negative regulation of membrane potential [inference]

negative regulation of mitochondrial membrane potential

regulation of mitochondrial membrane potential [inference]

negative regulation of mitochondrial membrane potential

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrion	IDA	PMID
mitochondrion	IEA	GO_REF
mitochondrion	HDA	PMID PMID
mitochondrial inner membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

cell body [inference]

neuronal cell body

apical part of cell

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
proton transmembrane transporter activity	ISO	GO_REF
proton transmembrane transporter activity	IEA	GO_REF
chloride transmembrane transporter activity	ISO	GO_REF
chloride transmembrane transporter activity	IEA	GO_REF
transmembrane transporter activity

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity

monoatomic anion transmembrane transporter activity [inference]

chloride transmembrane transporter activity

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPIAEEEKLLPLTQRWPRTSKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDKHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNISTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSADCLIQAVQGEGFLSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGVSPF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
91				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
The fatty acid cycling model	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements