GlyCosmos Portal

Submissions

Tubulin beta-4A chain

Summary

UniProt ID: Q9D6F9
Gene Symbol: Tubb4 Tubb4a
Gene ID: 22153
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9D6F9
PubChem: Q9D6F9
RaftProt: Q9D6F9
O-GlcNAcAtlas: Q9D6F9
Re-Glyco: Q9D6F9

Annotation

Keyword: Cilium biogenesis/degradation Cytoskeleton Direct protein sequencing GTP-binding Isopeptide bond Magnesium Metal-binding Microtubule Phosphoprotein Reference proteome

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
microtubule cytoskeleton organization
mitotic cell cycle	IBA	GO_REF
cell projection organization
negative regulation of microtubule polymerization	ISO	GO_REF
negative regulation of microtubule polymerization	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule cytoskeleton organization

cell cycle [inference]

mitotic cell cycle

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization

cell projection organization

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of microtubule polymerization

negative regulation of supramolecular fiber organization [inference]

negative regulation of microtubule polymerization

regulation of cellular process [inference]

regulation of microtubule-based process [inference]

regulation of microtubule cytoskeleton organization [inference]

regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization

regulation of microtubule polymerization [inference]

negative regulation of microtubule polymerization

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of microtubule polymerization

regulation of protein polymerization [inference]

regulation of microtubule polymerization [inference]

negative regulation of microtubule polymerization

negative regulation of protein polymerization [inference]

negative regulation of microtubule polymerization

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of microtubule polymerization

negative regulation of supramolecular fiber organization [inference]

negative regulation of microtubule polymerization

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization

regulation of cytoskeleton organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization

regulation of microtubule cytoskeleton organization [inference]

regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization

regulation of microtubule polymerization [inference]

negative regulation of microtubule polymerization

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of microtubule polymerization

regulation of protein polymerization [inference]

regulation of microtubule polymerization [inference]

negative regulation of microtubule polymerization

negative regulation of protein polymerization [inference]

negative regulation of microtubule polymerization

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of microtubule polymerization or depolymerization [inference]

negative regulation of microtubule polymerization

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of microtubule polymerization

negative regulation of supramolecular fiber organization [inference]

negative regulation of microtubule polymerization

regulation of supramolecular fiber organization [inference]

regulation of microtubule polymerization [inference]

negative regulation of microtubule polymerization

negative regulation of supramolecular fiber organization [inference]

negative regulation of microtubule polymerization

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	IDA	PMID
microtubule	ISO	GO_REF
microtubule	IEA	GO_REF GO_REF
cilium	ISO	GO_REF
cilium	IDA	PMID PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell projection

plasma membrane bounded cell projection [inference]

cilium

myelin sheath

organelle [inference]

membrane-bounded organelle [inference]

cilium

membraneless organelle [inference]

intracellular membraneless organelle [inference]

spindle [inference]

mitotic spindle

cytoskeleton [inference]

microtubule cytoskeleton

intracellular organelle [inference]

intracellular membraneless organelle [inference]

spindle [inference]

mitotic spindle

cytoskeleton [inference]

microtubule cytoskeleton

cell body [inference]

neuronal cell body

intercellular bridge

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

microtubule

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	IEA	GO_REF
structural constituent of cytoskeleton	IBA	GO_REF
structural constituent of cytoskeleton	IEA	GO_REF
calcium ion binding	ISO	GO_REF
calcium ion binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

structural molecule activity [inference]

structural constituent of cytoskeleton

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

cation binding [inference]

metal ion binding [inference]

calcium ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	GlyTouCan ID	Source
285	G49108TO	GlyGen
337	G76868JS	GlyGen
370	G13193DT	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 29 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
AURKA Activation by TPX2	Mus musculus
Aggrephagy	Mus musculus
Anchoring of the basal body to the plasma membrane	Mus musculus
COPI-dependent Golgi-to-ER retrograde traffic	Mus musculus
COPI-independent Golgi-to-ER retrograde traffic	Mus musculus
COPI-mediated anterograde transport	Mus musculus
Carboxyterminal post-translational modifications of tubulin	Mus musculus
Cargo trafficking to the periciliary membrane	Mus musculus
EML4 and NUDC in mitotic spindle formation	Mus musculus
HSP90 chaperone cycle for SHRs	Mus musculus