GlyCosmos Portal

Submissions

Ribose-phosphate pyrophosphokinase 1

Summary

UniProt ID: Q9D7G0
Gene Symbol: Prps1
Gene ID: 19139
Organism: Mus musculus (house mouse)

External Links

GlyConnect

Ribose-phosphate pyrophosphokinase 1

GlyGen

Q9D7G0

PubChem

Q9D7G0

RaftProt

Q9D7G0

Re-Glyco

Q9D7G0

Annotation

Keyword: ATP-binding Direct protein sequencing Kinase Magnesium Metal-binding Nucleotide biosynthesis Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
5-phosphoribose 1-diphosphate biosynthetic process	IDA	PMID
5-phosphoribose 1-diphosphate biosynthetic process	IBA	GO_REF
5-phosphoribose 1-diphosphate biosynthetic process	IEA	GO_REF GO_REF
pentose-phosphate shunt	IMP	PMID
pentose-phosphate shunt	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

ribose phosphate metabolic process [inference]

ribose phosphate biosynthetic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

5-phosphoribose 1-diphosphate metabolic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

glucose 6-phosphate metabolic process [inference]

pentose-phosphate shunt

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

ribose phosphate metabolic process [inference]

ribose phosphate biosynthetic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

5-phosphoribose 1-diphosphate metabolic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

glucose 6-phosphate metabolic process [inference]

pentose-phosphate shunt

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

small molecule biosynthetic process [inference]

urate biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process [inference]

hypoxanthine biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process

purine nucleobase biosynthetic process [inference]

hypoxanthine biosynthetic process

urate biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

nucleobase metabolic process [inference]

purine nucleobase metabolic process

purine nucleobase biosynthetic process [inference]

hypoxanthine biosynthetic process

hypoxanthine metabolic process [inference]

hypoxanthine biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process [inference]

hypoxanthine biosynthetic process

small molecule metabolic process [inference]

small molecule biosynthetic process [inference]

urate biosynthetic process

urate metabolic process [inference]

urate biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

ribonucleoside monophosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

nucleobase metabolic process [inference]

purine nucleobase metabolic process

purine nucleobase biosynthetic process [inference]

hypoxanthine biosynthetic process

hypoxanthine metabolic process [inference]

hypoxanthine biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process [inference]

hypoxanthine biosynthetic process

purine-containing compound metabolic process [inference]

purine nucleobase metabolic process

purine nucleobase biosynthetic process [inference]

hypoxanthine biosynthetic process

hypoxanthine metabolic process [inference]

hypoxanthine biosynthetic process

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

urate metabolic process [inference]

urate biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process

purine nucleobase biosynthetic process [inference]

hypoxanthine biosynthetic process

urate biosynthetic process

pyridine-containing compound metabolic process [inference]

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADPH regeneration [inference]

pentose-phosphate shunt

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribose phosphate biosynthetic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

5-phosphoribose 1-diphosphate metabolic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

glucose 6-phosphate metabolic process [inference]

pentose-phosphate shunt

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

5-phosphoribose 1-diphosphate biosynthetic process

developmental process [inference]

anatomical structure development [inference]

system development [inference]

nervous system development

Displaying **all 5** entries
GO Term	Evidence Code	Reference
ribose phosphate diphosphokinase complex	ISO	GO_REF
ribose phosphate diphosphokinase complex	IBA	GO_REF
cytoplasm	IBA	GO_REF
cytosol	IDA	PMID
protein-containing complex	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex

catalytic complex [inference]

transferase complex [inference]

transferase complex, transferring phosphorus-containing groups [inference]

ribose phosphate diphosphokinase complex

cellular anatomical structure [inference]

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
magnesium ion binding	ISO	GO_REF
magnesium ion binding	IEA	GO_REF
ribose phosphate diphosphokinase activity	ISS	GO_REF
ribose phosphate diphosphokinase activity	ISO	GO_REF GO_REF
ribose phosphate diphosphokinase activity	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity

diphosphotransferase activity [inference]

ribose phosphate diphosphokinase activity

binding [inference]

protein binding [inference]

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

carbohydrate binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

ADP binding

cation binding [inference]

AMP binding

metal ion binding [inference]

magnesium ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites