GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Large ribosomal subunit protein bL12m

Summary

UniProt ID: Q9DB15
Gene Symbol: Mrpl12 Rpml12
Gene ID: 56282
Organism: Mus musculus (house mouse)

External Links

PubChem: Q9DB15
The O-GlcNAc Database: Q9DB15
Re-Glyco: Q9DB15

Annotation

Keyword: Acetylation Direct protein sequencing Isopeptide bond Mitochondrion Reference proteome Ribosomal protein Transit peptide Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrial transcription	ISO	GO_REF
mitochondrial transcription	IEA	GO_REF
translation	IBA	GO_REF
translation	IEA	GO_REF
mitochondrial translation	NAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

mitochondrial translation

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mitochondrial transcription

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mitochondrial transcription

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

mitochondrial translation

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mitochondrial transcription

protein metabolic process [inference]

mitochondrial translation

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mitochondrial RNA metabolic process [inference]

mitochondrial transcription

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mitochondrial transcription

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mitochondrial transcription

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mitochondrial transcription

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mitochondrial RNA metabolic process [inference]

mitochondrial transcription

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mitochondrial transcription

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mitochondrial transcription

protein metabolic process [inference]

mitochondrial translation

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrion	IEA	GO_REF
mitochondrion	HDA	PMID
mitochondrial inner membrane	NAS	PMID
mitochondrial inner membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

mitochondrial protein-containing complex [inference]

mitochondrial large ribosomal subunit

ribonucleoprotein complex [inference]

ribosomal subunit [inference]

large ribosomal subunit [inference]

organellar large ribosomal subunit [inference]

mitochondrial large ribosomal subunit

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

mitochondrial matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribosome [inference]

organellar ribosome [inference]

mitochondrial ribosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular membraneless organelle [inference]

ribosome [inference]

organellar ribosome [inference]

mitochondrial ribosome

Displaying **all 3** entries
GO Term	Evidence Code	Reference
mRNA binding
structural constituent of ribosome	IBA	GO_REF
structural constituent of ribosome	IEA	GO_REF

GO Hierarchy

molecular function

structural molecule activity [inference]

structural constituent of ribosome

binding [inference]

nucleic acid binding [inference]

RNA binding [inference]

mRNA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLPVAASRCLWGPRLGLRGAALRLARQQMPSVCAARQLRSSSHRRSEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGPVSAAAPASEAAEEEDVPKQKERTHFTVRLTEAKPVDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
170		40885482	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Mitochondrial protein degradation	Mus musculus
Mitochondrial ribosome-associated quality control	Mus musculus
Mitochondrial translation elongation	Mus musculus
Mitochondrial translation termination	Mus musculus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026