GlyCosmos Portal

Submissions

Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase

Summary

UniProt ID: Q9DCL9
Gene Symbol: Paics
Gene ID: 67054
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9DCL9
PubChem: Q9DCL9
Re-Glyco: Q9DCL9

Annotation

Keyword: ATP-binding Acetylation Decarboxylase Ligase Multifunctional enzyme Phosphoprotein Purine biosynthesis Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
GMP biosynthetic process	ISO	PMID
GMP biosynthetic process	IEA	GO_REF
'de novo' IMP biosynthetic process	ISO	PMID
'de novo' IMP biosynthetic process	IBA	GO_REF
'de novo' IMP biosynthetic process	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleobase biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleobase metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleobase metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process

purine-containing compound metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleobase biosynthetic process

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
cytoplasm	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
phosphoribosylaminoimidazole carboxylase activity	ISS	GO_REF
phosphoribosylaminoimidazole carboxylase activity	ISO	PMID GO_REF
phosphoribosylaminoimidazole carboxylase activity	IEA	GO_REF GO_REF GO_REF
phosphoribosylaminoimidazolesuccinocarboxamide synthase activity	ISS	GO_REF
phosphoribosylaminoimidazolesuccinocarboxamide synthase activity	ISO	PMID GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

lyase activity [inference]

carbon-carbon lyase activity [inference]

carboxy-lyase activity [inference]

phosphoribosylaminoimidazole carboxylase activity

ligase activity [inference]

ligase activity, forming carbon-nitrogen bonds [inference]

acid-amino acid ligase activity [inference]

phosphoribosylaminoimidazolesuccinocarboxamide synthase activity

binding [inference]

protein binding [inference]

identical protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MATAVVVNIGKKLYEGKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYKFYPPKVEMFFKDDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSWLPQDCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVADRVELLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQDVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASILNTWISLKQADKKVRQCNL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites