GlyCosmos Portal

Submissions

Carboxypeptidase N catalytic chain

Summary

UniProt ID: Q9EQV8
Gene Symbol: Cpn1
Gene ID: 365466
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: Q9EQV8
Re-Glyco: Q9EQV8

Annotation

Keyword: Carboxypeptidase Disulfide bond Glycoprotein Metal-binding Metalloprotease Reference proteome Secreted Signal Zinc

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
peptide metabolic process	IBA	GO_REF
bradykinin catabolic process	IMP	PMID
protein processing	IBA	GO_REF
protein catabolic process	IDA	PMID
response to glucocorticoid	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

peptide metabolic process

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

bradykinin catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

protein metabolic process [inference]

proteolysis [inference]

protein processing

protein catabolic process

protein maturation [inference]

protein processing

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing

protein catabolic process

protein maturation [inference]

protein processing

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to chemical [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to lipid [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
carboxypeptidase activity	ISO	GO_REF
carboxypeptidase activity	IDA	PMID
carboxypeptidase activity	IMP	PMID
carboxypeptidase activity	IEA	GO_REF GO_REF
metallocarboxypeptidase activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

exopeptidase activity [inference]

carboxypeptidase activity

metallocarboxypeptidase activity

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

exopeptidase activity [inference]

carboxypeptidase activity

metallocarboxypeptidase activity

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPDLPSAFLPLLLLSKFVTPVTFRHHRYDDLVRTLYKVHNQCPDITRLYNIGRSVKGRYLYVLEFSDYPGTHEPLEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRILRLIQDTRIHILPSMNPDGYEVAAAQGPNTSGYLVGRNNANGVDLNRNFPDLNTYFYYNSKYGGPNHHLPLPDNWKSQVEPETRAVIQWIRSLNFVLSANMHGGAVVANYPYDKSLEHRFRSPHRTSNSPTPDDELFQTLAKVYSYAHGWMHQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCNKFPRQEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLTGAVISVTGINHDVTSGEHGDYFRLLLPGTYSVTAKASGYEPKTVTVTVGPAGPTLVDFQLKRSTTQVHPVQKAPGRGQGSRAKQPRTSRKKDQAAKRHRGPA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
400	O-linked (GalNAc...) threonine	UniProt
402	O-linked (GalNAc...) threonine	UniProt
409	O-linked (GalNAc...) threonine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Regulation of Complement cascade	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements