GlyCosmos Portal

Submissions

Carboxypeptidase B2

Summary

UniProt ID: Q9EQV9
Gene Symbol: Cpb2
Gene ID: 113936
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: Q9EQV9
Re-Glyco: Q9EQV9

Annotation

Keyword: Carboxypeptidase Disulfide bond Fibrinolysis Glycoprotein Metal-binding Metalloprotease Reference proteome Secreted Signal Zinc Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of extracellular matrix constituent secretion	IMP	PMID
proteolysis	IBA	GO_REF
proteolysis	IEA	GO_REF
blood coagulation
response to xenobiotic stimulus	IEP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

protein metabolic process [inference]

primary metabolic process [inference]

protein metabolic process [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

multicellular organismal process [inference]

coagulation [inference]

blood coagulation

developmental process [inference]

anatomical structure development [inference]

regeneration [inference]

animal organ regeneration [inference]

liver regeneration

animal organ development [inference]

animal organ regeneration [inference]

liver regeneration

gland development [inference]

liver development [inference]

liver regeneration

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

response to stimulus [inference]

response to chemical [inference]

response to xenobiotic stimulus

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose [inference]

cellular response to glucose stimulus

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

regulation of secretion by cell [inference]

regulation of extracellular matrix constituent secretion [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

positive regulation of hemostasis [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of hepatocyte proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of wound healing [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of hepatocyte proliferation

regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of hepatocyte proliferation

regulation of hepatocyte proliferation [inference]

negative regulation of hepatocyte proliferation

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of hepatocyte proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix constituent secretion

regulation of extracellular matrix organization [inference]

regulation of extracellular matrix constituent secretion [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix constituent secretion

regulation of secretion by cell [inference]

regulation of extracellular matrix constituent secretion [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of hemostasis [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

regulation of biological quality [inference]

regulation of body fluid levels [inference]

hemostasis [inference]

blood coagulation

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of hemostasis [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
carboxypeptidase activity	ISO	GO_REF
carboxypeptidase activity	IDA	PMID
carboxypeptidase activity	IEA	GO_REF
metallocarboxypeptidase activity	IBA	GO_REF
metallocarboxypeptidase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

exopeptidase activity [inference]

carboxypeptidase activity

metallocarboxypeptidase activity

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

exopeptidase activity [inference]

carboxypeptidase activity

metallocarboxypeptidase activity

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLYGLGVLVAIILYEKHGLAFQSGHVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVNSVKAYLNASRIPFNVLMNNVEDLIQQQTSNDTVSPRASSSYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSYEKYPLYVLKVSGKEHRVKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENTYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSVHMNNRCVGTDLNRNFASKHWCEKGASSFSCSETYCGLYPESEPEVKAVADFLRRNINHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERFIKPTCAEALAAVSKIAWHVIRNS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
43	N-linked (GlcNAc...) asparagine	UniProt
72	N-linked (GlcNAc...) asparagine	UniProt
84	N-linked (GlcNAc...) asparagine	UniProt
107	N-linked (GlcNAc...) asparagine	UniProt
240	N-linked (GlcNAc...) asparagine	UniProt
322	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Metabolism of Angiotensinogen to Angiotensins	Rattus norvegicus
Regulation of Complement cascade	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements