GlyCosmos Portal

Submissions

Synaptosomal-associated protein 29

Summary

UniProt ID: Q9ERB0
Gene Symbol: Snap29
Gene ID: 67474
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9ERB0
RaftProt: Q9ERB0
O-GlcNAcAtlas: Q9ERB0
Re-Glyco: Q9ERB0

Annotation

Keyword: Autophagy Cell membrane Cilium Cilium biogenesis/degradation Coiled coil Cytoplasm Cytoplasmic vesicle Golgi apparatus Phosphoprotein Protein transport Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
exocytosis	IBA	GO_REF
protein transport
synaptic vesicle priming	IBA	GO_REF
autophagosome membrane docking	IEA	GO_REF
synaptic vesicle fusion to presynaptic active zone membrane	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

vesicle-mediated transport [inference]

exocytosis

membrane docking [inference]

organelle localization by membrane tethering [inference]

autophagosome membrane docking

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vesicle organization [inference]

vesicle fusion [inference]

vesicle fusion to plasma membrane [inference]

synaptic vesicle fusion to presynaptic active zone membrane

cilium organization [inference]

cilium assembly

organelle fusion [inference]

organelle membrane fusion [inference]

vesicle fusion [inference]

vesicle fusion to plasma membrane [inference]

synaptic vesicle fusion to presynaptic active zone membrane

organelle assembly [inference]

cilium assembly

cellular component disassembly [inference]

protein-containing complex disassembly [inference]

autophagosome maturation

cellular component assembly [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

cilium assembly

protein-containing complex assembly [inference]

synaptic vesicle priming

organelle assembly [inference]

cilium assembly

cell projection organization [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

cilium assembly

plasma membrane bounded cell projection organization [inference]

cilium organization [inference]

cilium assembly

plasma membrane bounded cell projection assembly [inference]

cilium assembly

protein-containing complex organization [inference]

protein-containing complex disassembly [inference]

autophagosome maturation

protein-containing complex assembly [inference]

synaptic vesicle priming

membrane organization [inference]

synaptic vesicle membrane organization [inference]

synaptic vesicle fusion to presynaptic active zone membrane

membrane fusion [inference]

organelle membrane fusion [inference]

vesicle fusion [inference]

vesicle fusion to plasma membrane [inference]

synaptic vesicle fusion to presynaptic active zone membrane

exocytic process [inference]

synaptic vesicle priming

vesicle fusion to plasma membrane [inference]

synaptic vesicle fusion to presynaptic active zone membrane

export from cell [inference]

secretion by cell [inference]

exocytosis

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport

establishment of localization [inference]

transport [inference]

protein transport

vesicle-mediated transport [inference]

exocytosis

secretion [inference]

secretion by cell [inference]

exocytosis

export from cell [inference]

secretion by cell [inference]

exocytosis

establishment of protein localization [inference]

protein transport

organelle localization [inference]

organelle localization by membrane tethering [inference]

autophagosome membrane docking

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of synaptic vesicle exocytosis

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of neurotransmitter transport [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of synaptic vesicle exocytosis

regulation of synaptic vesicle cycle

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of synaptic vesicle exocytosis

regulation of synaptic vesicle cycle

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of synaptic vesicle exocytosis

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	ISS	GO_REF
Golgi membrane	ISO	GO_REF
Golgi membrane	IEA	GO_REF
autophagosome membrane	IEA	GO_REF
cytoplasm	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

SNARE complex

cellular anatomical structure [inference]

cytoplasm

microtubule organizing center [inference]

centrosome

cytosol

membrane [inference]

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

vacuolar membrane [inference]

autophagosome membrane

ciliary membrane [inference]

ciliary pocket membrane

plasma membrane region [inference]

cell projection membrane [inference]

ciliary membrane [inference]

ciliary pocket membrane

extrinsic component of membrane [inference]

extrinsic component of organelle membrane [inference]

extrinsic component of synaptic vesicle membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

vacuole [inference]

autophagosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

autophagosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

Displaying **all 3** entries
GO Term	Evidence Code	Reference
SNAP receptor activity	IBA	GO_REF
syntaxin binding	ISO	GO_REF
syntaxin binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

SNARE binding [inference]

syntaxin binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

SNAP receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSGYPKSYNPFDDDVEEEDTRPAPWKDVRDLPDGPDAPIDRQQYLRQEVLRRAEATAASTSRSLSLMYESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPEQNGSIVSQPNSRLKEAINTSKDQENKYQASHPNLRRLQDAELDSVPKEPSSTVNTEVYPKNSTLRTYHQKIDSNLDELSVGLGHLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
185		32848054	G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Intra-Golgi traffic	Mus musculus
Neutrophil degranulation	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0060337	CEDNIK syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements