GlyCosmos Portal

Submissions

Cathepsin K

Summary

UniProt ID: Q9GLE3
Gene Symbol: CTSK
Gene ID: 397569
Organism: Sus scrofa (pig)

External Links

PubChem: Q9GLE3
Re-Glyco: Q9GLE3

Annotation

Keyword: Cell membrane Disulfide bond Glycoprotein Lysosome Reference proteome Secreted Signal Thiol protease Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
thyroid hormone generation	ISS	GO_REF
thyroid hormone generation	IEA	GO_REF
collagen catabolic process	IEA	GO_REF
bone resorption
obsolete proteolysis involved in protein catabolic process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

modified amino acid metabolic process [inference]

thyroid hormone metabolic process [inference]

thyroid hormone generation

catabolic process [inference]

collagen catabolic process

phenol-containing compound metabolic process [inference]

thyroid hormone metabolic process [inference]

thyroid hormone generation

collagen metabolic process [inference]

collagen catabolic process

hormone metabolic process [inference]

thyroid hormone metabolic process [inference]

thyroid hormone generation

multicellular organismal process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

bone resorption

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

bone resorption

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of developmental process [inference]

negative regulation of cartilage development

negative regulation of multicellular organismal process [inference]

negative regulation of cartilage development

regulation of developmental process [inference]

negative regulation of developmental process [inference]

negative regulation of cartilage development

regulation of multicellular organismal development [inference]

regulation of cartilage development [inference]

negative regulation of cartilage development

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of cartilage development

regulation of multicellular organismal development [inference]

regulation of cartilage development [inference]

negative regulation of cartilage development

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

thyroid hormone metabolic process [inference]

thyroid hormone generation

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleoplasm
lysosome	IDA	PMID
lysosome	IBA	GO_REF
lysosome	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

nucleoplasm

membrane [inference]

plasma membrane region [inference]

apical plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

side of membrane [inference]

external side of plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
fibronectin binding	IEA	GO_REF
cysteine-type endopeptidase activity	IEA	GO_REF GO_REF
collagen binding	IEA	GO_REF
proteoglycan binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

cysteine-type endopeptidase activity

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

cysteine-type endopeptidase activity

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity

binding [inference]

protein binding [inference]

protein-containing complex binding [inference]

collagen binding

carbohydrate derivative binding [inference]

proteoglycan binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWGLKVVLLLPVMSSALYPEEILDTQWELWKKTYRKQYNSKVDEISRRLIWEKNLKHISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPPSHSRSNDTLYIPDWEGRTPDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDENCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQKGKKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
104	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Activation of Matrix Metalloproteinases	Sus scrofa
Collagen degradation	Sus scrofa
MHC class II antigen presentation	Sus scrofa
RUNX1 regulates transcription of genes involved in differentiation of keratinocytes	Sus scrofa
Trafficking and processing of endosomal TLR	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements