GlyCosmos Portal

Submissions

Very long chain fatty acid elongase 4

Summary

UniProt ID: Q9GZR5
Gene Symbol: ELOVL4
Gene ID: 6785
Organism: Homo sapiens (human)

External Links

GlyGen

Q9GZR5

PubChem

Q9GZR5

SwissLipids

SLP:000000255

The Human Metabolome Database

HMDBP04479

The O-GlcNAc Database

Q9GZR5

O-GlcNAcAtlas

Q9GZR5

Re-Glyco

Q9GZR5

Annotation

Keyword: Disease variant Endoplasmic reticulum Fatty acid biosynthesis Glycoprotein Ichthyosis Intellectual disability Proteomics identification Reference proteome Spinocerebellar ataxia Stargardt disease Transferase Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
fatty acid biosynthetic process	NAS	PMID
fatty acid biosynthetic process	IEA	GO_REF
unsaturated fatty acid biosynthetic process	IEA	GO_REF
fatty acid elongation, saturated fatty acid	IDA	PMID
fatty acid elongation, saturated fatty acid	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

sulfur compound biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

organophosphate biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

sphingolipid biosynthetic process

fatty acid derivative biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

sulfur compound biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

purine-containing compound biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

organophosphate biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

lipid metabolic process [inference]

fatty acid metabolic process [inference]

very long-chain fatty acid metabolic process [inference]

very long-chain fatty acid biosynthetic process

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

unsaturated fatty acid metabolic process [inference]

unsaturated fatty acid biosynthetic process

sphingolipid metabolic process [inference]

sphingolipid biosynthetic process

lipid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

sphingolipid biosynthetic process

fatty acid derivative biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty acid derivative metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty acid derivative biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

very long-chain fatty acid metabolic process [inference]

very long-chain fatty acid biosynthetic process

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

unsaturated fatty acid metabolic process [inference]

unsaturated fatty acid biosynthetic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid elongation [inference]

fatty acid elongation, saturated fatty acid

fatty acid elongation, unsaturated fatty acid [inference]

very long-chain fatty acid biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

purine-containing compound metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

purine-containing compound biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum	IEA	GO_REF
endoplasmic reticulum membrane	EXP	PMID
endoplasmic reticulum membrane	IDA	PMID
endoplasmic reticulum membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying **all 4** entries
GO Term	Evidence Code	Reference
G protein-coupled photoreceptor activity	NAS	PMID
fatty acid elongase activity	ISS	GO_REF
fatty acid elongase activity	EXP	PMID
fatty acid elongase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

acyltransferase activity [inference]

acyltransferase activity, transferring groups other than amino-acyl groups [inference]

fatty acid elongase activity

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled photoreceptor activity

photoreceptor activity [inference]

G protein-coupled photoreceptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGKTAMNGISANGVSKSEKQLMIENGKKQKNGKAKGD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
20	N-linked (GlcNAc...) asparagine	16036915 37074911	G80920RR G62765YT G31852PQ G41247ZX G02815KT	UniProt GlyGen
294		36240223	G49108TO	GlyGen The O-GlcNAc Database