GlyCosmos Portal

Submissions

Leucine-rich glioma-inactivated protein 1

Summary

UniProt ID: Q9JIA1
Gene Symbol: Lgi1
Gene ID: 56839
Organism: Mus musculus (house mouse)

External Links

GlyConnect

Leucine-rich glioma-inactivated protein 1

GlyGen

Q9JIA1

PubChem

Q9JIA1

The O-GlcNAc Database

Q9JIA1

Re-Glyco

Q9JIA1

Annotation

Keyword: 3D-structure Alternative splicing Cytoplasm Direct protein sequencing Endoplasmic reticulum Glycoprotein Golgi apparatus Leucine-rich repeat Reference proteome Repeat Secreted Signal Synapse

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
axon guidance	ISO	GO_REF
axon guidance	IEA	GO_REF
positive regulation of cell growth	ISO	GO_REF
positive regulation of cell growth	IEA	GO_REF
neuron projection development	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to postsynaptic membrane [inference]

protein localization to postsynaptic specialization membrane [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development

neuron projection guidance [inference]

axon guidance

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to organelle [inference]

protein localization to postsynaptic specialization membrane [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

protein localization to membrane [inference]

protein localization to postsynaptic membrane [inference]

protein localization to postsynaptic specialization membrane [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

protein localization to cell junction [inference]

protein localization to synapse [inference]

protein localization to postsynapse [inference]

protein localization to postsynaptic membrane [inference]

protein localization to postsynaptic specialization membrane [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

protein localization to cell periphery [inference]

protein localization to postsynaptic membrane [inference]

protein localization to postsynaptic specialization membrane [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

protein-containing complex localization [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to postsynaptic membrane [inference]

protein localization to postsynaptic specialization membrane [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

receptor localization to synapse [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

positive regulation of signaling [inference]

positive regulation of synaptic transmission

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

positive regulation of synaptic transmission

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of synaptic transmission

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of synaptic transmission

positive regulation of cell growth

regulation of cellular process [inference]

regulation of cell communication [inference]

positive regulation of cell communication [inference]

positive regulation of synaptic transmission

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

positive regulation of synaptic transmission

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of synaptic transmission

positive regulation of cell growth

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth

regulation of biological quality [inference]

regulation of postsynaptic membrane neurotransmitter receptor levels [inference]

neurotransmitter receptor localization to postsynaptic specialization membrane

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	EXP	PMID
cytoplasm	IDA	PMID
cytoplasm	IEA	GO_REF
endoplasmic reticulum	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

cell junction [inference]

synapse [inference]

glutamatergic synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying **all 3** entries
GO Term	Evidence Code	Reference
signaling receptor binding	ISO	GO_REF
signaling receptor binding	IEA	GO_REF
receptor ligand activity	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MESESSRRMGNACIPLKRIAYFLCLFSVVLLTEGKKPAKPKCPAVCTCSKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNAFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSPKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIDTQLYVIVAQLFGGSHIYKRDGFANKFIKIQDIEVLKIRKPNDIETFKIEDNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIARPPLALRTPHLILSSSSQRPVIYQWSKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
192	N-linked (GlcNAc...) asparagine			UniProt GlyGen
277	N-linked (GlcNAc...) asparagine		G02815KT	UniProt GlyGen
421		33300544 40021952 40684658	G49108TO	The O-GlcNAc Database
422	N-linked (GlcNAc...) asparagine	30899004	G82119TF G93180LE G25637MV G57776ZU G06110VR G66538GV	UniProt GlyGen GlyConnect