GlyCosmos Portal

Submissions

Proteasomal ubiquitin receptor ADRM1

Summary

UniProt ID: Q9JKV1
Gene Symbol: Adrm1 Gp110
Gene ID: 56436
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9JKV1
PubChem: Q9JKV1
The O-GlcNAc Database: Q9JKV1
O-GlcNAcAtlas: Q9JKV1
Re-Glyco: Q9JKV1

Annotation

Keyword: 3D-structure Acetylation Cytoplasm Isopeptide bond Nucleus Phosphoprotein Proteasome Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
ovarian follicle development	IMP	PMID
transcription elongation by RNA polymerase II	ISO	GO_REF
spermatid development	IMP	PMID
regulation of T cell differentiation in thymus	IMP	PMID
follicle-stimulating hormone signaling pathway	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway [inference]

follicle-stimulating hormone signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

cellular process involved in reproduction in multicellular organism [inference]

germ cell development [inference]

cellular developmental process [inference]

cell development [inference]

epithelial cell development [inference]

Sertoli cell development

germ cell development [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

proteasome assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

proteasome assembly

reproductive process [inference]

developmental process involved in reproduction [inference]

germ cell development [inference]

reproductive structure development [inference]

seminiferous tubule development

Sertoli cell development

ovulation cycle process [inference]

follicle-stimulating hormone signaling pathway

multicellular organismal reproductive process [inference]

gamete generation [inference]

female gamete generation [inference]

oogenesis

cellular process involved in reproduction in multicellular organism [inference]

germ cell development [inference]

developmental process [inference]

developmental process involved in reproduction [inference]

germ cell development [inference]

reproductive structure development [inference]

seminiferous tubule development

Sertoli cell development

anatomical structure development [inference]

ovarian follicle development

tissue development [inference]

connective tissue development [inference]

adipose tissue development

tube development [inference]

seminiferous tubule development

cell development [inference]

epithelial cell development [inference]

Sertoli cell development

germ cell development [inference]

animal organ development [inference]

hematopoietic or lymphoid organ development [inference]

thymus development

gland development [inference]

thymus development

reproductive structure development [inference]

seminiferous tubule development

cellular developmental process [inference]

cell development [inference]

epithelial cell development [inference]

Sertoli cell development

germ cell development [inference]

rhythmic process [inference]

ovulation cycle process [inference]

follicle-stimulating hormone signaling pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of leukocyte activation [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

regulation of growth hormone receptor signaling pathway [inference]

positive regulation of growth hormone receptor signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

regulation of growth hormone receptor signaling pathway [inference]

positive regulation of growth hormone receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

regulation of cell development [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway [inference]

follicle-stimulating hormone signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

regulation of growth hormone receptor signaling pathway [inference]

positive regulation of growth hormone receptor signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

regulation of cell differentiation [inference]

regulation of cell development [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of growth hormone receptor signaling pathway

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
proteasome complex	ISO	GO_REF
nucleoplasm	ISO	GO_REF
cytosol	ISO	GO_REF
cytosol	TAS	Reactome Reactome Reactome Reactome Reactome
plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

proteasome regulatory particle, lid subcomplex

intracellular protein-containing complex [inference]

proteasome complex

catalytic complex [inference]

peptidase complex [inference]

endopeptidase complex [inference]

proteasome complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protease binding	ISO	GO_REF
endopeptidase activator activity	ISO	GO_REF
endopeptidase activator activity	IBA	GO_REF
proteasome binding	ISO	GO_REF
proteasome binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

protease binding

protein-containing complex binding [inference]

proteasome binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

peptidase activator activity [inference]

endopeptidase activator activity

peptidase regulator activity [inference]

peptidase activator activity [inference]

endopeptidase activator activity

endopeptidase regulator activity [inference]

endopeptidase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

peptidase activator activity [inference]

endopeptidase activator activity

molecular function inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNNPPMPGSLGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSSTSSARATPAPSAPAAASATSPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	PubMed ID	GlyTouCan ID	Source
211	22645316 30016717 30059200 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
213	22645316 30016717 30059200 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
217			GlyGen
220	22645316 30016717 30059200 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
221	22645316 30016717 30059200 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
222	22645316 30016717 30059200 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
228			GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 55 in total

1

2

3

4

5

6

Next ›

Last »
Pathway Name	Organism
ABC-family protein mediated transport	Mus musculus
AMPK-induced ERAD and lysosome mediated degradation of PD-L1(CD274)	Mus musculus
APC/C:Cdc20 mediated degradation of Securin	Mus musculus
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1	Mus musculus
AUF1 (hnRNP D0) binds and destabilizes mRNA	Mus musculus
Activation of NF-kappaB in B cells	Mus musculus
Antigen processing: Ubiquitination & Proteasome degradation	Mus musculus
Assembly of the pre-replicative complex	Mus musculus
Asymmetric localization of PCP proteins	Mus musculus
Autodegradation of Cdh1 by Cdh1:APC/C	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements