GlyCosmos Portal

Submissions

C-type lectin domain family 1 member B

Summary

UniProt ID: Q9JL99
Gene Symbol: Clec1b Clec2
Gene ID: 56760
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0007599
GlyGen: Q9JL99
PubChem: Q9JL99
Re-Glyco: Q9JL99

Annotation

Keyword: Alternative splicing Disulfide bond Glycoprotein Lectin Phosphoprotein Receptor Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
signal transduction	ISS	GO_REF
signal transduction	ISO	GO_REF
signal transduction	IBA	GO_REF
signal transduction	IEA	GO_REF
cell surface receptor signaling pathway	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cell surface receptor signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation [inference]

platelet formation

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

platelet formation

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation [inference]

platelet formation

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction

cell surface receptor signaling pathway

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	IDA	PMID
plasma membrane	IBA	GO_REF
cell surface	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
transmembrane signaling receptor activity	ISA	PMID
transmembrane signaling receptor activity	ISS	GO_REF
transmembrane signaling receptor activity	ISO	GO_REF
transmembrane signaling receptor activity	IBA	GO_REF
transmembrane signaling receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

carbohydrate binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVALGIMSVTQQKYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHKCSPCATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERNAGMTRVDQLL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
67	N-linked (GlcNAc...) asparagine			UniProt GlyGen
120	N-linked (GlcNAc...) asparagine	22740230		GlycoProtDB UniProt GlyGen
134	N-linked (GlcNAc...) asparagine	22740230	G47310BX	GlycoProtDB UniProt GlyGen
184	N-linked (GlcNAc...) asparagine			UniProt GlyGen