GlyCosmos Portal

Submissions

Pulmonary surfactant-associated protein D

Summary

UniProt ID: Q9N1X4
Gene Symbol: SFTPD
Gene ID: 397198
Organism: Sus scrofa (pig)

External Links

PubChem: Q9N1X4
Re-Glyco: Q9N1X4

Annotation

Keyword: 3D-structure Calcium Coiled coil Collagen Disulfide bond Extracellular matrix Glycoprotein Hydroxylation Innate immunity Lectin Reference proteome Repeat S-nitrosylation Signal Surface film

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
respiratory gaseous exchange by respiratory system
surfactant homeostasis	ISS	GO_REF
surfactant homeostasis	IBA	GO_REF
innate immune response
lung alveolus development	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

multicellular organismal process [inference]

respiratory gaseous exchange by respiratory system

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

developmental process [inference]

anatomical structure development [inference]

lung alveolus development

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

chemical homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of cellular process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

Displaying **all 3** entries
GO Term	Evidence Code	Reference
collagen trimer
obsolete extracellular space
multivesicular body	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

Displaying 1 entry
GO Term	Evidence Code	Reference
carbohydrate binding

GO Hierarchy

molecular function

binding [inference]

carbohydrate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLLLPLSVLILLTQPPRSLGAEMKTYSQRAVANACALVMCSPMENGLPGRDGRDGREGPRGEKGDPGLPGAVGRAGMPGLAGPVGPKGDNGSTGEPGAKGDIGPCGPPGPPGIPGPAGKEGPSGQQGNIGPPGTPGPKGETGPKGEVGALGMQGSTGARGPAGLKGERGAPGERGAPGSAGAAGPAGATGPQGPSGARGPPGLKGDRGPPGERGAKGESGLPGITALRQQVETLQGQVQRLQKAFSQYKKVELFPNGRGVGEKIFKTGGFEKTFQDAQQVCTQAGGQMASPRSETENEALSQLVTAQNKAAFLSMTDIKTEGNFTYPTGEPLVYANWAPGEPNNNGGSSGAENCVEIFPNGKWNDKACGELRLVICEF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
90	N-linked (GlcNAc...) asparagine			UniProt
323	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Regulation of TLR by endogenous ligand	Sus scrofa
Signal regulatory protein family interactions	Sus scrofa
Surfactant metabolism	Sus scrofa
Toll Like Receptor 4 (TLR4) Cascade	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements