GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase

Summary

UniProt ID: Q9NDH7
Gene Symbol: C55B7.2 gly-2
Gene ID: 172360
Organism: Caenorhabditis elegans

External Links

PubChem: Q9NDH7
Re-Glyco: Q9NDH7

Annotation

Keyword: Glycoprotein Glycosyltransferase Golgi apparatus Metal-binding Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
protein N-linked glycosylation	IDA	PMID
protein N-linked glycosylation	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

primary metabolic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

Displaying **all 4** entries
GO Term	Evidence Code	Reference
Golgi membrane	IEA	GO_REF
nucleus	IDA	PMID
Golgi apparatus	IBA	GO_REF
Golgi stack	TAS	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

Golgi stack

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
calmodulin binding	IPI	PMID
hexosyltransferase activity	ISS	PMID
hexosyltransferase activity	IDA	PMID
hexosyltransferase activity	IEA	GO_REF
alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

acetylglucosaminyltransferase activity [inference]

alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity

hexosyltransferase activity

acetylglucosaminyltransferase activity [inference]

alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity

catalytic activity, acting on a protein [inference]

catalytic activity, acting on a glycoprotein [inference]

alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity

binding [inference]

protein binding [inference]

calmodulin binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRRRHRCVALLFIFSAFITPLGFFYYTISNESKRYSEESEKNYGYQTLEFTESPEEISVDFDKYSQSECSRFPSNVEIEYPECLNKMKWIKNGWKTHHCYIENHIDGSECSFRYYLSQVENYCPPMEHHGKRKGLAKISPSIRRLLPIFESIPHYMKTRINRLWKKWKEGAHEVMQKYPKSMIERRKLNVLVFIGFLANEQKLNMAKKSDHGGPLGELLQWSDLLATLSVIGHHLEVSTNKNTLRNIVWKYMSRGPCQYVNNFRQQLDIIFTDIMGFNILRQHHRQFLLSNRCRIRLLDSFGTHAEFTTKTYFVQNKKSLSGPFSQRNPWGGHGLDLRQHWTFYPHSDDNTFLGFVVDTEGIDKKNNQMIPSALVYGKEQYMWRDAEKPIDVLKRIVTVHSTVADLDLKDSNISSIFKKVQNHGFLNSEEISQLLDNITIFFGLGFPLEGPAPLEAMAHGAVFINAKFKEPKSRLNYKFLAEKPTLRKWTSQNPYMEKIGEPHVITVDIFNELELEEAIKRAISLKPKHFVPFEFTPAGMLHRVALLLEKQELCDKIAYSKRWPPIDQMKIFRTLNADDSCETICHSKQLLCEPSYFPIINSSPLLRRENLCSSTTSDSSPFAPFNCTIQQSAFLFSCASSPPISFEINRLCPCRDYIPEQHAICKKCL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
30	N-linked (GlcNAc...) asparagine			UniProt
412	N-linked (GlcNAc...) asparagine			UniProt
437	N-linked (GlcNAc...) asparagine			UniProt
626	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
DAG1 core M2 glycosylations	Caenorhabditis elegans
N-Glycan antennae elongation	Caenorhabditis elegans

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026