GlyCosmos Portal

Submissions

NAD-dependent protein deacylase sirtuin-5, mitochondrial

Summary

UniProt ID: Q9NXA8
Gene Symbol: SIRT5 SIR2L5
Gene ID: 23408
Organism: Homo sapiens (human)

External Links

PubChem: Q9NXA8
The Human Metabolome Database: HMDBP08883
The O-GlcNAc Database: Q9NXA8
Re-Glyco: Q9NXA8

Annotation

Keyword: 3D-structure Alternative splicing Cytoplasm Metal-binding Mitochondrion NAD Nucleus Proteomics identification Reference proteome Transferase Transit peptide Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
response to ischemia
protein deacetylation	IDA	PMID PMID
mitochondrion organization	TAS	Reactome
regulation of ketone biosynthetic process	ISS	GO_REF
regulation of ketone biosynthetic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-lysine modification [inference]

protein deacylation [inference]

protein deacetylation

protein demalonylation

peptidyl-lysine demalonylation

protein desuccinylation

peptidyl-lysine desuccinylation

protein deglutarylation

macromolecule modification [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-lysine modification [inference]

protein deacylation [inference]

protein deacetylation

protein demalonylation

peptidyl-lysine demalonylation

protein desuccinylation

peptidyl-lysine desuccinylation

protein deglutarylation

macromolecule deacylation [inference]

protein deacylation [inference]

protein deacetylation

protein demalonylation

peptidyl-lysine demalonylation

protein desuccinylation

peptidyl-lysine desuccinylation

protein deglutarylation

primary metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-lysine modification [inference]

protein deacylation [inference]

protein deacetylation

protein demalonylation

peptidyl-lysine demalonylation

protein desuccinylation

peptidyl-lysine desuccinylation

protein deglutarylation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

response to stimulus [inference]

response to stress [inference]

response to ischemia

response to nutrient levels

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of reactive oxygen species metabolic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of ketone biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of reactive oxygen species metabolic process

regulation of ketone metabolic process [inference]

regulation of ketone biosynthetic process

regulation of small molecule metabolic process [inference]

regulation of ketone biosynthetic process

regulation of reactive oxygen species metabolic process [inference]

negative regulation of reactive oxygen species metabolic process

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of muscle cell apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of striated muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of cardiac muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of reactive oxygen species metabolic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	TAS	PMID
nucleus	IEA	GO_REF
mitochondrion	IDA	PMID PMID GO_REF GO_REF
mitochondrion	IBA	GO_REF
mitochondrion	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

mitochondrial matrix

organelle envelope lumen [inference]

mitochondrial intermembrane space

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
zinc ion binding	IDA	PMID
zinc ion binding	IEA	GO_REF
histone deacetylase activity, NAD-dependent	IBA	GO_REF
NAD-dependent protein lysine deacetylase activity	TAS	Reactome
NAD-dependent protein lysine deacetylase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

acyltransferase activity [inference]

acyltransferase activity, transferring groups other than amino-acyl groups [inference]

NAD-dependent protein lysine deacylase activity [inference]

NAD-dependent protein lysine deacetylase activity

histone deacetylase activity, NAD-dependent

hydrolase activity [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [inference]

protein-malonyllysine demalonylase activity

catalytic activity, acting on a protein [inference]

protein lysine deacetylase activity [inference]

histone deacetylase activity [inference]

histone deacetylase activity, NAD-dependent

protein-malonyllysine demalonylase activity

histone modifying activity [inference]

histone deacetylase activity [inference]

histone deacetylase activity, NAD-dependent

NAD-dependent protein lysine deacylase activity [inference]

NAD-dependent protein lysine deacetylase activity

histone deacetylase activity, NAD-dependent

deacylase activity [inference]

deacetylase activity [inference]

protein lysine deacetylase activity [inference]

histone deacetylase activity [inference]

histone deacetylase activity, NAD-dependent

NAD-dependent protein lysine deacylase activity [inference]

NAD-dependent protein lysine deacetylase activity

histone deacetylase activity, NAD-dependent

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

NAD+ binding

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding [inference]

NAD+ binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding [inference]

NAD+ binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites