GlyCosmos Portal

Submissions

Vesicle-associated membrane protein-associated protein B

Summary

UniProt ID: Q9QY76
Gene Symbol: Vapb
Gene ID
Organism: Mus musculus (house mouse)

External Links

PubChem: Q9QY76
The O-GlcNAc Database: Q9QY76
RaftProt: Q9QY76
Re-Glyco: Q9QY76

Annotation

Keyword: 3D-structure Acetylation Coiled coil Endoplasmic reticulum Isopeptide bond Phosphoprotein Reference proteome Transmembrane helix Ubl conjugation Unfolded protein response

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
intracellular calcium ion homeostasis	ISS	GO_REF
intracellular calcium ion homeostasis	ISO	GO_REF
endoplasmic reticulum to Golgi vesicle-mediated transport	ISO	GO_REF
endoplasmic reticulum organization	ISO	GO_REF
viral release from host cell	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

endoplasmic reticulum unfolded protein response

IRE1-mediated unfolded protein response

intercellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

membrane docking [inference]

organelle localization by membrane tethering [inference]

endoplasmic reticulum-plasma membrane tethering

cellular localization [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

endoplasmic reticulum unfolded protein response

IRE1-mediated unfolded protein response

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

endoplasmic reticulum organization

vesicle organization [inference]

vesicle budding from membrane [inference]

COPII-coated vesicle budding

membrane organization [inference]

vesicle budding from membrane [inference]

COPII-coated vesicle budding

endoplasmic reticulum membrane organization

viral process [inference]

viral release from host cell

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

biological process involved in interspecies interaction between organisms [inference]

modulation of process of another organism [inference]

host-mediated perturbation of symbiont process [inference]

host-mediated perturbation of viral process [inference]

host-mediated activation of viral process [inference]

host-mediated activation of viral genome replication

host-mediated perturbation of viral genome replication [inference]

host-mediated activation of viral genome replication

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

exit from host cell [inference]

viral release from host cell

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

suppression of viral release by host

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to virus [inference]

suppression of viral release by host

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

endoplasmic reticulum unfolded protein response

IRE1-mediated unfolded protein response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

suppression of viral release by host

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

suppression of viral release by host

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

endoplasmic reticulum unfolded protein response

IRE1-mediated unfolded protein response

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

sterol transport [inference]

cholesterol transport

intercellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

organic hydroxy compound transport [inference]

sterol transport [inference]

cholesterol transport

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

establishment of localization in cell [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

organelle localization [inference]

endoplasmic reticulum localization [inference]

endoplasmic reticulum-plasma membrane tethering

organelle localization by membrane tethering [inference]

endoplasmic reticulum-plasma membrane tethering

cellular localization [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of viral process [inference]

positive regulation of viral genome replication

negative regulation of biological process [inference]

negative regulation of viral process [inference]

negative regulation by virus of viral protein levels in host cell

regulation of viral process [inference]

regulation by virus of viral protein levels in host cell [inference]

negative regulation by virus of viral protein levels in host cell

positive regulation of viral process [inference]

positive regulation of viral genome replication

negative regulation of viral process [inference]

negative regulation by virus of viral protein levels in host cell

regulation of viral life cycle [inference]

regulation of viral genome replication [inference]

positive regulation of viral genome replication

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

endoplasmic reticulum unfolded protein response

IRE1-mediated unfolded protein response

regulation of biological quality [inference]

regulation by virus of viral protein levels in host cell [inference]

negative regulation by virus of viral protein levels in host cell

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
endoplasmic reticulum	ISO	GO_REF GO_REF
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	ISO	GO_REF
endoplasmic reticulum membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane

plasma membrane

organelle membrane [inference]

endoplasmic reticulum membrane

cell junction [inference]

synapse [inference]

glutamatergic synapse

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
microtubule binding	ISO	GO_REF
enzyme binding	ISO	GO_REF
FFAT motif binding	ISO	GO_REF
protein homodimerization activity	ISO	GO_REF
protein-membrane adaptor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

tubulin binding [inference]

enzyme binding

protein domain specific binding [inference]

FFAT motif binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

protein-membrane adaptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTVPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDDTEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRVRKAMPSNSPVAALAATGKEEGLSARLLALVVLFFIVGVIIGKIAL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites