GlyCosmos Portal

Submissions

Mitochondrial import receptor subunit TOM40 homolog

Summary

UniProt ID: Q9QYA2
Gene Symbol: Tomm40 Mom35 Tom40
Gene ID: 53333
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9QYA2
PubChem: Q9QYA2
RaftProt: Q9QYA2
Re-Glyco: Q9QYA2

Annotation

Keyword: Direct protein sequencing Mitochondrion outer membrane Porin Protein transport Reference proteome Transmembrane beta strand

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete protein targeting to mitochondrion
protein import into mitochondrial matrix	ISS	GO_REF
protein import into mitochondrial matrix	ISO	GO_REF GO_REF
protein import into mitochondrial matrix	IBA	GO_REF
protein import into mitochondrial matrix	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

intercellular transport [inference]

protein import into mitochondrial matrix

cellular localization [inference]

localization within membrane [inference]

establishment of protein localization to membrane [inference]

protein insertion into membrane [inference]

protein insertion into mitochondrial membrane

transmembrane transport [inference]

protein transmembrane transport [inference]

protein import into mitochondrial matrix

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization [inference]

mitochondrial membrane organization [inference]

protein insertion into mitochondrial membrane

membrane organization [inference]

mitochondrial membrane organization [inference]

protein insertion into mitochondrial membrane

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

protein transmembrane transport [inference]

protein import into mitochondrial matrix

protein localization to organelle [inference]

protein localization to mitochondrion [inference]

protein import into mitochondrial matrix

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

protein import into mitochondrial matrix

protein transport [inference]

protein transmembrane transport [inference]

protein import into mitochondrial matrix

transmembrane transport [inference]

protein transmembrane transport [inference]

protein import into mitochondrial matrix

establishment of protein localization [inference]

protein transport [inference]

protein transmembrane transport [inference]

protein import into mitochondrial matrix

establishment of protein localization to organelle [inference]

establishment of protein localization to membrane [inference]

protein insertion into membrane [inference]

protein insertion into mitochondrial membrane

establishment of localization in cell [inference]

protein insertion into mitochondrial membrane

cellular localization [inference]

localization within membrane [inference]

establishment of protein localization to membrane [inference]

protein insertion into membrane [inference]

protein insertion into mitochondrial membrane

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

regulation of cellular process [inference]

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF GO_REF
mitochondrion	IDA	PMID
mitochondrion	IEA	GO_REF
mitochondrion	HDA	PMID PMID
mitochondrial outer membrane	ISO	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

pore complex

outer mitochondrial membrane protein complex [inference]

mitochondrial outer membrane translocase complex

mitochondrial protein-containing complex [inference]

outer mitochondrial membrane protein complex [inference]

mitochondrial outer membrane translocase complex

cellular anatomical structure [inference]

cytosol

membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

organelle membrane contact site [inference]

mitochondria-associated endoplasmic reticulum membrane contact site

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
monoatomic cation channel activity	ISO	GO_REF
transmembrane protein transporter activity	ISO	GO_REF
transmembrane protein transporter activity	IBA	GO_REF
transmembrane protein transporter activity	IEA	GO_REF
porin activity

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity

wide pore channel activity [inference]

porin activity

macromolecule transmembrane transporter activity [inference]

transmembrane protein transporter activity

protein transporter activity [inference]

transmembrane protein transporter activity

binding [inference]

protein binding [inference]

preprotein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGNVLAASSPPAGPPPPPTPSLVGLPPPPPSPPGFTLPPLGGGLGTGSSTGRGSERTPGAAASGAAAASEDGSCGCLPNPGTFEECHRKCKELFPVQMEGVKLTVNKGLSNRFQVTHTVALGTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLSPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSASFGYQLDLPKANFLFKGSVNSNWIVGATLEKKLPPLPLTLSLCAFLNHRKNKFLCGFGLTIG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
19				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
PINK1-PRKN Mediated Mitophagy	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements