GlyCosmos Portal

Submissions

Peptidyl-prolyl cis-trans isomerase E

Summary

UniProt ID: Q9QZH3
Gene Symbol: Ppie Cyp33
Gene ID: 56031
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9QZH3
PubChem: Q9QZH3
The O-GlcNAc Database: Q9QZH3
O-GlcNAcAtlas: Q9QZH3
Re-Glyco: Q9QZH3

Annotation

Keyword: Nucleus Phosphoprotein RNA-binding Reference proteome Rotamase Spliceosome

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
mRNA splicing, via spliceosome	ISS	GO_REF
mRNA splicing, via spliceosome	ISO	GO_REF
mRNA splicing, via spliceosome	IEA	GO_REF GO_REF
regulation of DNA-templated transcription	ISO	GO_REF
regulation of transcription, DNA-templated	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

protein folding

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

RNA processing [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

RNA splicing [inference]

RNA splicing, via transesterification reactions [inference]

RNA splicing, via transesterification reactions with bulged adenosine as nucleophile [inference]

mRNA splicing, via spliceosome

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of viral process [inference]

positive regulation of viral genome replication

regulation of viral process [inference]

positive regulation of viral process [inference]

positive regulation of viral genome replication

regulation of viral life cycle [inference]

regulation of viral genome replication [inference]

positive regulation of viral genome replication

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF GO_REF
cytoplasm
cytosol	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

nuclear protein-containing complex [inference]

spliceosomal complex [inference]

U2-type spliceosomal complex [inference]

U2-type catalytic step 2 spliceosome

catalytic step 2 spliceosome

U2-type catalytic step 2 spliceosome

catalytic complex [inference]

catalytic step 2 spliceosome

U2-type catalytic step 2 spliceosome

ribonucleoprotein complex [inference]

spliceosomal complex [inference]

U2-type spliceosomal complex [inference]

U2-type catalytic step 2 spliceosome

catalytic step 2 spliceosome

U2-type catalytic step 2 spliceosome

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mRNA binding	ISS	GO_REF
mRNA binding	ISO	GO_REF
mRNA binding	IEA	GO_REF
peptidyl-prolyl cis-trans isomerase activity	ISS	GO_REF
peptidyl-prolyl cis-trans isomerase activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

isomerase activity [inference]

cis-trans isomerase activity [inference]

peptidyl-prolyl cis-trans isomerase activity

catalytic activity, acting on a protein [inference]

peptidyl-prolyl cis-trans isomerase activity

binding [inference]

nucleic acid binding [inference]

RNA binding [inference]

single-stranded RNA binding [inference]

poly-purine tract binding [inference]

poly(A) binding

mRNA binding

cyclosporin A binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGPEPPKAEAQEGEPTAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVMIADCGEYM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
168		30059200	G49108TO	GlyGen The O-GlcNAc Database
207			G84349RE	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Dual incision in TC-NER	Mus musculus
Formation of TC-NER Pre-Incision Complex	Mus musculus
Gap-filling DNA repair synthesis and ligation in TC-NER	Mus musculus
Neutrophil degranulation	Mus musculus
pre-mRNA splicing	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements