GlyCosmos Portal

Submissions

Collagen alpha-3(IV) chain

Summary

UniProt ID: Q9QZS0
Gene Symbol: Col4a3
Gene ID: 12828
Organism: Mus musculus (house mouse)

External Links

Re-Glyco: Q9QZS0

Annotation

Keyword: Basement membrane Cell adhesion Collagen Disulfide bond Glycoprotein Phosphoprotein Reference proteome Repeat Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cell adhesion
cell surface receptor signaling pathway	IDA	PMID
negative regulation of angiogenesis	ISO	GO_REF
negative regulation of angiogenesis	IDA	PMID
negative regulation of angiogenesis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

signal transduction [inference]

cell surface receptor signaling pathway

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

collagen-activated signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

endothelial cell apoptotic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization [inference]

external encapsulating structure organization [inference]

extracellular matrix organization [inference]

developmental process [inference]

anatomical structure development [inference]

glomerular basement membrane development

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

collagen-activated signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

regulation of epithelial cell proliferation [inference]

regulation of endothelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

regulation of vascular endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
collagen type IV trimer	ISO	GO_REF
collagen type IV trimer	NAS	PMID
collagen type IV trimer	IDA	PMID
collagen type IV trimer	IBA	GO_REF
collagen type IV trimer	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer [inference]

network-forming collagen trimer [inference]

collagen type IV trimer

extracellular protein-containing complex [inference]

network-forming collagen trimer [inference]

collagen type IV trimer

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

basement membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying **all 5** entries
GO Term	Evidence Code	Reference
integrin binding	ISS	GO_REF
integrin binding	ISO	GO_REF
integrin binding	IEA	GO_REF
extracellular matrix structural constituent conferring tensile strength	RCA	PMID
extracellular matrix structural constituent conferring tensile strength	IBA	GO_REF

GO Hierarchy

molecular function

structural molecule activity [inference]

extracellular matrix structural constituent [inference]

extracellular matrix structural constituent conferring tensile strength

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

cell adhesion molecule binding [inference]

integrin binding

protein-containing complex binding [inference]

integrin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MHSKTAPRFLVFLLLTLLLLLAASPVASKGCVCKGKGQCLCAGTKGEKGEKGVPGSPGFPGQKGFPGPEGLPGPQGPKGSPGLPGLTGPKGIRGITGLPGFAGPPGLPGLPGHPGPRGLAGLPGCNGSKGEQGFPGFPGTPGYAGLPGPDGLKGQKGEPAQGEDRGFNGKGDPGPPGVPGFQGFPGLPGFPGPAGPPGPPGFFGLPGAMGPRGPKGHMGDSVIGQKGERGMKGLTGPPGPPGTVIFTLTQPYNKSDFKGEKGDEGERGEPGPPGPSGPPGDSYGSEKGAPGEPGPRGKPGKDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPGLPGPKGARGPQGPSGPPGVPGSPGLSRPGLRGPIGWPGLKGSKGERGPPGKDTVGPPGPLGCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPPGVPGLDGPKGEPGSPCTECHCFPGPPGVPGFPGLDGIKGIPGGRGVPGLKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDKGDTPLPWGQVGNPGDPGLRGLPGRKGFDGTPGGPGAKGPPGPQGEPALSGRKGDQGPPGPPGFPGPPGPAGPAGPPGYGPQGEPGPKGAQGVPGVLGPPGEAGLKGEPSTSTPDLGPPGPPGPPGQAGPRGLPGLPGPVGKCDPGLPGPDGEPGIPEAGCPGPPGPKGNQGFPGTKGSPGCPGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKRH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
126	N-linked (GlcNAc...) asparagine			UniProt
253	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0110033	Alport syndrome 2	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements