GlyCosmos Portal

Submissions

Serine racemase

Summary

UniProt ID: Q9QZX7
Gene Symbol: Srr
Gene ID: 27364
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9QZX7
PubChem: Q9QZX7
Re-Glyco: Q9QZX7

Annotation

Keyword: ATP-binding Allosteric enzyme Alternative splicing Calcium Direct protein sequencing Isomerase Lyase Magnesium Manganese Metal-binding Phosphoprotein Pyridoxal phosphate Reference proteome S-nitrosylation

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
L-serine metabolic process	ISO	PMID GO_REF GO_REF
L-serine metabolic process	IDA	PMID PMID PMID PMID
L-serine metabolic process	IEA	GO_REF GO_REF
response to xenobiotic stimulus	IEA	GO_REF
response to lipopolysaccharide	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

amino acid biosynthetic process [inference]

alpha-amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

pyruvate biosynthetic process

non-proteinogenic amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

alpha-amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

primary metabolic process [inference]

amino acid metabolic process [inference]

amino acid biosynthetic process [inference]

alpha-amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

proteinogenic amino acid metabolic process [inference]

L-serine metabolic process

non-proteinogenic amino acid metabolic process [inference]

D-amino acid metabolic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

non-proteinogenic amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

alpha-amino acid metabolic process [inference]

D-amino acid metabolic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

L-amino acid metabolic process [inference]

L-serine metabolic process

alpha-amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

pyruvate biosynthetic process

non-proteinogenic amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

alpha-amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

pyruvate metabolic process [inference]

pyruvate biosynthetic process

monocarboxylic acid biosynthetic process [inference]

pyruvate biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

pyruvate biosynthetic process

non-proteinogenic amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

alpha-amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

proteinogenic amino acid metabolic process [inference]

L-serine metabolic process

non-proteinogenic amino acid metabolic process [inference]

D-amino acid metabolic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

non-proteinogenic amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

alpha-amino acid metabolic process [inference]

D-amino acid metabolic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

L-amino acid metabolic process [inference]

L-serine metabolic process

alpha-amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

pyruvate biosynthetic process

non-proteinogenic amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

alpha-amino acid biosynthetic process [inference]

D-amino acid biosynthetic process [inference]

D-serine biosynthetic process

response to stimulus [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to chemical [inference]

response to xenobiotic stimulus

response to lipid [inference]

response to lipopolysaccharide

response to nitrogen compound [inference]

response to ketamine

response to oxygen-containing compound [inference]

response to lipopolysaccharide

response to ketone [inference]

response to ketamine

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF
neuronal cell body	ISO	GO_REF
neuronal cell body	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

cell body [inference]

neuronal cell body

apical part of cell

Displaying entries **1 - 5** of 29 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
magnesium ion binding	ISO	GO_REF GO_REF
magnesium ion binding	IBA	GO_REF
magnesium ion binding	IEA	GO_REF
L-serine ammonia-lyase activity	ISO	GO_REF
L-serine ammonia-lyase activity	IDA	PMID PMID

GO Hierarchy

molecular function

catalytic activity [inference]

lyase activity [inference]

carbon-nitrogen lyase activity [inference]

ammonia-lyase activity [inference]

isomerase activity [inference]

racemase and epimerase activity [inference]

racemase and epimerase activity, acting on amino acids and derivatives [inference]

amino-acid racemase activity [inference]

binding [inference]

protein binding [inference]

protein domain specific binding [inference]

PDZ domain binding

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

amino acid binding [inference]

glycine binding

small molecule binding [inference]

vitamin binding [inference]

vitamin B6 binding [inference]

pyridoxal phosphate binding

ion binding [inference]

anion binding [inference]

pyridoxal phosphate binding

carboxylic acid binding [inference]

glycine binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

glycine binding

metal ion binding [inference]

organic acid binding [inference]

carboxylic acid binding [inference]

glycine binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

vitamin B6 binding [inference]

pyridoxal phosphate binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MCAQYCISFADVEKAHINIQDSIHLTPVLTSSILNQIAGRNLFFKCELFQKTGSFKIRGALNAIRGLIPDTPEEKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPNCKKLAIQAYGASIVYCDPSDESREKVTQRIMQETEGILVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMVAGIAITIKALKPSVKVYAAEPSNADDCYQSKLKGELTPNLHPPETIADGVKSSIGLNTWPIIRDLVDDVFTVTEDEIKYATQLVWGRMKLLIEPTAGVALAAVLSQHFQTVSPEVKNVCIVLSGGNVDLTSLNWVGQAERPAPYQTVSV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites