GlyCosmos Portal

Submissions

Adenylate kinase isoenzyme 1

Summary

UniProt ID: Q9R0Y5
Gene Symbol: Ak1
Gene ID: 11636
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0007714
PubChem: Q9R0Y5
RaftProt: Q9R0Y5
Re-Glyco: Q9R0Y5

Annotation

Keyword: ATP-binding Acetylation Alternative splicing Cytoplasm Direct protein sequencing Kinase Phosphoprotein Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
ADP biosynthetic process	ISO	GO_REF
ADP biosynthetic process	IEA	GO_REF
nucleoside triphosphate biosynthetic process	IEA	GO_REF
positive regulation of D-glucose transmembrane transport	ISO	GO_REF
AMP metabolic process	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate metabolic process [inference]

AMP metabolic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

nucleoside phosphate biosynthetic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate metabolic process [inference]

AMP metabolic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

nucleoside phosphate biosynthetic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

small molecule biosynthetic process [inference]

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

glycosyl compound biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate metabolic process [inference]

AMP metabolic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

nucleoside phosphate biosynthetic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleoside metabolic process [inference]

ribonucleoside metabolic process [inference]

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine ribonucleoside metabolic process [inference]

inosine metabolic process [inference]

inosine biosynthetic process

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine nucleoside metabolic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine ribonucleoside metabolic process [inference]

inosine metabolic process [inference]

inosine biosynthetic process

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

small molecule metabolic process [inference]

small molecule biosynthetic process [inference]

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate metabolic process [inference]

AMP metabolic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

nucleoside phosphate biosynthetic process [inference]

nucleoside diphosphate biosynthetic process [inference]

purine nucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

ribonucleoside diphosphate biosynthetic process [inference]

purine ribonucleoside diphosphate biosynthetic process [inference]

ADP biosynthetic process

nucleoside triphosphate biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

nucleoside metabolic process [inference]

ribonucleoside metabolic process [inference]

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine ribonucleoside metabolic process [inference]

inosine metabolic process [inference]

inosine biosynthetic process

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine nucleoside metabolic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine ribonucleoside metabolic process [inference]

inosine metabolic process [inference]

inosine biosynthetic process

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

purine nucleoside metabolic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine ribonucleoside metabolic process [inference]

inosine metabolic process [inference]

inosine biosynthetic process

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

carbohydrate derivative metabolic process [inference]

nucleoside metabolic process [inference]

ribonucleoside metabolic process [inference]

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine ribonucleoside metabolic process [inference]

inosine metabolic process [inference]

inosine biosynthetic process

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine nucleoside metabolic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

purine ribonucleoside metabolic process [inference]

inosine metabolic process [inference]

inosine biosynthetic process

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ADP metabolic process [inference]

ADP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ADP biosynthetic process

glycosyl compound biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

inosine biosynthetic process

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

regulation of D-glucose transmembrane transport [inference]

positive regulation of D-glucose transmembrane transport

positive regulation of transmembrane transport [inference]

positive regulation of D-glucose transmembrane transport

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of D-glucose transmembrane transport

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of transmembrane transport [inference]

positive regulation of D-glucose transmembrane transport

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of D-glucose transmembrane transport

regulation of cellular process [inference]

regulation of transmembrane transport [inference]

regulation of D-glucose transmembrane transport [inference]

positive regulation of D-glucose transmembrane transport

positive regulation of transmembrane transport [inference]

positive regulation of D-glucose transmembrane transport

positive regulation of cellular process [inference]

positive regulation of transmembrane transport [inference]

positive regulation of D-glucose transmembrane transport

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic cell cycle phase transition [inference]

regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle process [inference]

regulation of cell cycle phase transition [inference]

regulation of mitotic cell cycle phase transition [inference]

regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle G1/S phase transition [inference]

regulation of G1/S transition of mitotic cell cycle

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
outer dense fiber	IDA	PMID
cytoplasm	ISS	GO_REF
cytoplasm	IDA	PMID
cytoplasm	IEA	GO_REF GO_REF GO_REF
cytosol	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

sarcomere

cell projection [inference]

plasma membrane bounded cell projection [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

organelle [inference]

membrane-bounded organelle [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

perinuclear region of cytoplasm

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

outer dense fiber

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
AMP kinase activity	ISS	GO_REF
AMP kinase activity	ISO	GO_REF GO_REF
AMP kinase activity	IDA	PMID PMID PMID
AMP kinase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF
nucleoside diphosphate kinase activity	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

nucleobase-containing compound kinase activity [inference]

nucleoside diphosphate kinase activity

deoxynucleoside phosphate kinase activity, ATP as phosphate donor [inference]

dAMP kinase activity

nucleoside monophosphate kinase activity [inference]

AMP kinase activity

phosphotransferase activity, phosphate group as acceptor [inference]

nucleoside diphosphate kinase activity

deoxynucleoside phosphate kinase activity, ATP as phosphate donor [inference]

dAMP kinase activity

nucleoside monophosphate kinase activity [inference]

AMP kinase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
155				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Interconversion of nucleotide di- and triphosphates	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements