GlyCosmos Portal

Submissions

Mitochondrial peptide methionine sulfoxide reductase

Summary

UniProt ID: Q9UJ68
Gene Symbol: MSRA
Gene ID: 4482
Organism: Homo sapiens (human)

External Links

GlyGen: Q9UJ68
PubChem: Q9UJ68
The Human Metabolome Database: HMDBP00521
Re-Glyco: Q9UJ68

Annotation

Keyword: Acetylation Alternative initiation Alternative promoter usage Alternative splicing Cytoplasm Disulfide bond Membrane Mitochondrion Myristate Nucleus Oxidoreductase Proteomics identification Redox-active center Reference proteome Transit peptide

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
L-methionine metabolic process
response to oxidative stress	TAS	PMID
protein repair	TAS	Reactome
cellular response to oxidative stress
protein modification process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

sulfur amino acid metabolic process [inference]

L-methionine metabolic process

macromolecule metabolic process [inference]

protein metabolic process [inference]

macromolecule modification [inference]

protein modification process

primary metabolic process [inference]

amino acid metabolic process [inference]

proteinogenic amino acid metabolic process [inference]

L-methionine metabolic process

alpha-amino acid metabolic process [inference]

L-amino acid metabolic process [inference]

L-methionine metabolic process

protein metabolic process [inference]

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

sulfur amino acid metabolic process [inference]

L-methionine metabolic process

proteinogenic amino acid metabolic process [inference]

L-methionine metabolic process

alpha-amino acid metabolic process [inference]

L-amino acid metabolic process [inference]

L-methionine metabolic process

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

response to stimulus [inference]

response to stress [inference]

response to oxidative stress

cellular response to oxidative stress

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	EXP	PMID
nucleus	IDA	PMID
nucleus	IEA	GO_REF
nucleoplasm	IDA	GO_REF
cytoplasm	EXP	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

mitochondrial matrix

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular membraneless organelle [inference]

nuclear body

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
peptide-methionine (S)-S-oxide reductase activity	EXP	PMID
peptide-methionine (S)-S-oxide reductase activity	TAS	PMID Reactome
peptide-methionine (S)-S-oxide reductase activity	IDA	PMID PMID
peptide-methionine (S)-S-oxide reductase activity	IEA	GO_REF GO_REF GO_REF GO_REF
L-methionine (S)-S-oxide reductase activity	EXP	PMID PMID

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on a sulfur group of donors [inference]

oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor [inference]

catalytic activity, acting on a protein [inference]

peptide-methionine (S)-S-oxide reductase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
164				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Protein repair	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements