GlyCosmos Portal

Submissions

Membrane-associated transporter protein

Summary

UniProt ID: Q9UMX9
Gene Symbol: SLC45A2 AIM1 MATP
Gene ID: 51151
Organism: Homo sapiens (human)

External Links

PubChem: Q9UMX9
Re-Glyco: Q9UMX9

Annotation

Keyword: Albinism Alternative splicing Disease variant Glycoprotein Melanin biosynthesis Proteomics identification Reference proteome Symport Transmembrane helix Vision

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
melanin biosynthetic process from tyrosine	ISS	GO_REF
melanin biosynthetic process from tyrosine	IDA	PMID
melanin biosynthetic process from tyrosine	IBA	GO_REF
melanin biosynthetic process from tyrosine	IEA	GO_REF
visual perception

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

secondary metabolite biosynthetic process [inference]

melanin biosynthetic process [inference]

melanin biosynthetic process from tyrosine

phenol-containing compound biosynthetic process [inference]

melanin biosynthetic process [inference]

melanin biosynthetic process from tyrosine

phenol-containing compound metabolic process [inference]

melanin metabolic process [inference]

melanin biosynthetic process [inference]

melanin biosynthetic process from tyrosine

phenol-containing compound biosynthetic process [inference]

melanin biosynthetic process [inference]

melanin biosynthetic process from tyrosine

secondary metabolic process [inference]

melanin metabolic process [inference]

melanin biosynthetic process [inference]

melanin biosynthetic process from tyrosine

secondary metabolite biosynthetic process [inference]

melanin biosynthetic process [inference]

melanin biosynthetic process from tyrosine

pigment metabolic process [inference]

melanin metabolic process [inference]

melanin biosynthetic process [inference]

melanin biosynthetic process from tyrosine

pigment biosynthetic process [inference]

melanin biosynthetic process [inference]

melanin biosynthetic process from tyrosine

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of light stimulus [inference]

visual perception

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH elevation [inference]

lysosomal lumen pH elevation

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH elevation [inference]

lysosomal lumen pH elevation

monoatomic cation homeostasis [inference]

regulation of pH [inference]

regulation of intracellular pH [inference]

intracellular pH elevation [inference]

lysosomal lumen pH elevation

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH elevation [inference]

lysosomal lumen pH elevation

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH elevation [inference]

lysosomal lumen pH elevation

pigmentation [inference]

developmental pigmentation

localization [inference]

establishment of localization [inference]

transport [inference]

carbohydrate transport [inference]

oligosaccharide transport [inference]

disaccharide transport [inference]

sucrose transport

biological regulation [inference]

regulation of pH [inference]

regulation of intracellular pH [inference]

intracellular pH elevation [inference]

lysosomal lumen pH elevation

regulation of biological quality [inference]

regulation of intracellular pH [inference]

intracellular pH elevation [inference]

lysosomal lumen pH elevation

Displaying **all 4** entries
GO Term	Evidence Code	Reference
membrane
melanosome membrane	IDA	PMID
melanosome membrane	IBA	GO_REF
melanosome membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

pigment granule membrane [inference]

melanosome membrane

bounding membrane of organelle [inference]

pigment granule membrane [inference]

melanosome membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
D-glucose:proton symporter activity	ISS	GO_REF
D-glucose:proton symporter activity	IEA	GO_REF
sucrose:proton symporter activity	ISS	GO_REF
sucrose:proton symporter activity	IEA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity [inference]

solute:proton symporter activity [inference]

carbohydrate:proton symporter activity [inference]

sucrose:proton symporter activity

hexose:proton symporter activity [inference]

D-glucose:proton symporter activity

solute:monoatomic cation symporter activity [inference]

carbohydrate:monoatomic cation symporter activity [inference]

carbohydrate:proton symporter activity [inference]

sucrose:proton symporter activity

hexose:proton symporter activity [inference]

D-glucose:proton symporter activity

sucrose:monoatomic cation symporter activity [inference]

sucrose:proton symporter activity

solute:proton symporter activity [inference]

carbohydrate:proton symporter activity [inference]

sucrose:proton symporter activity

hexose:proton symporter activity [inference]

D-glucose:proton symporter activity

carbohydrate transmembrane transporter activity [inference]

carbohydrate:monoatomic cation symporter activity [inference]

carbohydrate:proton symporter activity [inference]

sucrose:proton symporter activity

hexose:proton symporter activity [inference]

D-glucose:proton symporter activity

sucrose:monoatomic cation symporter activity [inference]

sucrose:proton symporter activity

oligosaccharide transmembrane transporter activity [inference]

disaccharide transmembrane transporter activity [inference]

sucrose transmembrane transporter activity [inference]

sucrose:monoatomic cation symporter activity [inference]

sucrose:proton symporter activity

sugar transmembrane transporter activity [inference]

monosaccharide transmembrane transporter activity [inference]

hexose transmembrane transporter activity [inference]

hexose:proton symporter activity [inference]

D-glucose:proton symporter activity

D-glucose transmembrane transporter activity [inference]

D-glucose:proton symporter activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

symporter activity [inference]

solute:monoatomic cation symporter activity [inference]

carbohydrate:monoatomic cation symporter activity [inference]

carbohydrate:proton symporter activity [inference]

sucrose:proton symporter activity

hexose:proton symporter activity [inference]

D-glucose:proton symporter activity

sucrose:monoatomic cation symporter activity [inference]

sucrose:proton symporter activity

solute:proton symporter activity [inference]

carbohydrate:proton symporter activity [inference]

sucrose:proton symporter activity

hexose:proton symporter activity [inference]

D-glucose:proton symporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGALGYLLGAIDWAHLELGRLLGTEFQVMFFFSALVLTLCFTVHLCSISEAPLTEVAKGIPPQQTPQDPPLSSDGMYEYGSIEKVKNGYVNPELAMQGAKNKNHAEQTRRAMTLKSLLRALVNMPPHYRYLCISHLIGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGLCINSVFSSLYSYFQKVLVSYIGLKGLYFTGYLLFGLGTGFIGLFPNVYSTLVLCSLFGVMSSTLYTVPFNLITEYHREEEKERQQAPGGDPDNSVRGKGMDCATLTCMVQLAQILVGGGLGFLVNTAGTVVVVVITASAVALIGCCFVALFVRYVD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
356	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Melanin biosynthesis	Homo sapiens

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:10123	pigmentation disease	Alliance of Genome Resources
DOID:0070098	oculocutaneous albinism type IV	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements