GlyCosmos Portal

Submissions

LD23870p

Summary

UniProt ID: Q9VHC0
Gene Symbol: CG16788 DEK Dmel\CG16788 Dmel_CG16788 RNPS1 RnpS1 Rnps1 cg16788 rnps1
Gene ID: 41147
Organism: Drosophila melanogaster (fruit fly)

External Links

The O-GlcNAc Database: Q9VHC0
Re-Glyco: Q9VHC0

Annotation

Keyword: Nucleus Proteomics identification RNA-binding Reference proteome mRNA splicing

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
mRNA splicing, via spliceosome
RNA splicing	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

RNA processing [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

RNA splicing

RNA splicing, via transesterification reactions [inference]

RNA splicing, via transesterification reactions with bulged adenosine as nucleophile [inference]

mRNA splicing, via spliceosome

Displaying **all 3** entries
GO Term	Evidence Code	Reference
nucleoplasm	HDA	PMID
cytoplasm	IBA	GO_REF
ASAP complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

ASAP complex

cellular anatomical structure [inference]

Displaying 1 entry
GO Term	Evidence Code	Reference
mRNA binding	ISS	PMID

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

RNA binding [inference]

mRNA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MARAQSLAGEGEKEKDNKEKVAKEKDGKATSGSSRRDRERKRRGSASSSSDSRSSTSDSSSSRSSSGSSRSSSSSSSDSSSSSSSSSSDSDRSEKNRRRGGGAAGKDKDKDKPSARSRSRSRTRSPRRVSKSPRPGSKARKEPERDRDRRSRSRDRARRAGSNDRAAADSNNVKRERSRSASRSRSPRRRGRGSVERTPPPKRRERSRSRTRSPSPKQVRIHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATPEDCESAMKHMDGGQIDGQEITVSPVVLVKQRPPMRRPSPPMRRPQNNRWRSPPQFNRFNNRGGGGGGGGGRRQSPMRNRRSPRRRSRSPIRRRRRSNSSDSSR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
367		40245499	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)	Drosophila melanogaster
Transport of Mature mRNA derived from an Intron-Containing Transcript	Drosophila melanogaster
pre-mRNA splicing	Drosophila melanogaster