GlyCosmos Portal

Submissions

NPC intracellular cholesterol transporter 2 homolog a

Summary

UniProt ID: Q9VQ62
Gene Symbol: CG7291 NPC2 Npc2a
Gene ID: 33374
Organism: Drosophila melanogaster (fruit fly)

External Links

The O-GlcNAc Database: Q9VQ62
Re-Glyco: Q9VQ62

Annotation

Keyword: Disulfide bond Glycoprotein Reference proteome Secreted Signal Steroid biosynthesis

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
synaptic target recognition	IMP	PMID
sterol transport	IMP	PMID
sterol transport	IBA	GO_REF
sterol transport	IEA	GO_REF
intracellular cholesterol transport	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell recognition [inference]

neuron recognition [inference]

synaptic target recognition

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

ecdysteroid biosynthetic process

hormone biosynthetic process [inference]

ecdysteroid biosynthetic process

small molecule biosynthetic process [inference]

ketone biosynthetic process [inference]

ecdysteroid biosynthetic process

ketone metabolic process [inference]

ketone biosynthetic process [inference]

ecdysteroid biosynthetic process

ecdysteroid metabolic process [inference]

ecdysteroid biosynthetic process

hormone metabolic process [inference]

hormone biosynthetic process [inference]

ecdysteroid biosynthetic process

ecdysteroid metabolic process [inference]

ecdysteroid biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

steroid metabolic process [inference]

steroid biosynthetic process [inference]

ecdysteroid biosynthetic process

ecdysteroid metabolic process [inference]

ecdysteroid biosynthetic process

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

ecdysteroid biosynthetic process

small molecule metabolic process [inference]

small molecule biosynthetic process [inference]

ketone biosynthetic process [inference]

ecdysteroid biosynthetic process

cellular localization [inference]

intracellular transport [inference]

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

homeostatic process [inference]

chemical homeostasis [inference]

lipid homeostasis [inference]

sterol homeostasis

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

sterol transport

cholesterol transport [inference]

intracellular cholesterol transport

intracellular sterol transport [inference]

intracellular cholesterol transport

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

organic hydroxy compound transport [inference]

sterol transport

cholesterol transport [inference]

intracellular cholesterol transport

intracellular sterol transport [inference]

intracellular cholesterol transport

intracellular transport [inference]

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

cellular localization [inference]

intracellular transport [inference]

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of defense response to bacterium

positive regulation of defense response [inference]

positive regulation of defense response to bacterium

positive regulation of response to external stimulus [inference]

positive regulation of defense response to bacterium

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of defense response to bacterium

regulation of defense response to bacterium [inference]

positive regulation of defense response to bacterium

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of defense response to bacterium

regulation of defense response to bacterium [inference]

positive regulation of defense response to bacterium

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of defense response to bacterium

positive regulation of defense response [inference]

positive regulation of defense response to bacterium

positive regulation of response to external stimulus [inference]

positive regulation of defense response to bacterium

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of defense response to bacterium

regulation of defense response to bacterium [inference]

positive regulation of defense response to bacterium

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

hormone biosynthetic process [inference]

ecdysteroid biosynthetic process

ecdysteroid metabolic process [inference]

ecdysteroid biosynthetic process

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
lipopolysaccharide binding	IDA	PMID
cholesterol binding	ISS	GO_REF
lipid antigen binding	IDA	PMID
sterol binding	ISS	PMID
sterol binding	IEA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

lipid transfer activity [inference]

sterol transfer activity [inference]

cholesterol transfer activity

binding [inference]

antigen binding [inference]

lipid antigen binding

lipid binding [inference]

lipopolysaccharide binding

steroid binding [inference]

sterol binding

cholesterol binding

lipid antigen binding

small molecule binding [inference]

alcohol binding [inference]

cholesterol binding

carbohydrate derivative binding [inference]

lipopolysaccharide binding

glycosaminoglycan binding [inference]

peptidoglycan binding

lipoteichoic acid binding

molecular carrier activity [inference]

lipid carrier activity [inference]

lipid transfer activity [inference]

sterol transfer activity [inference]

cholesterol transfer activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLRYAVIACAALVVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKIQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
51	N-linked (GlcNAc...) asparagine			UniProt
52		40245499	G49108TO	The O-GlcNAc Database
53		40245499	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements