GlyCosmos Portal

Submissions

Peptidoglycan-recognition protein SB2

Summary

UniProt ID: Q9VV96
Gene Symbol: CG9697 PGRP-SB2
Gene ID: 39869
Organism: Drosophila melanogaster (fruit fly)

External Links

Re-Glyco: Q9VV96

Annotation

Keyword: Disulfide bond Glycoprotein Hydrolase Innate immunity Metal-binding Reference proteome Secreted Signal Zinc

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
peptidoglycan catabolic process	ISS	PMID
peptidoglycan catabolic process	NAS	PMID
peptidoglycan catabolic process	IEA	GO_REF
innate immune response	NAS	PMID
innate immune response	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

macromolecule metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

glycosaminoglycan metabolic process [inference]

peptidoglycan metabolic process [inference]

peptidoglycan catabolic process

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

macromolecule catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

carbohydrate derivative metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

glycosaminoglycan metabolic process [inference]

peptidoglycan metabolic process [inference]

peptidoglycan catabolic process

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

Displaying **all 2** entries
GO Term	Evidence Code	Reference
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying **all 5** entries
GO Term	Evidence Code	Reference
zinc ion binding	IEA	GO_REF
N-acetylmuramoyl-L-alanine amidase activity	ISS	PMID
N-acetylmuramoyl-L-alanine amidase activity	IBA	GO_REF
N-acetylmuramoyl-L-alanine amidase activity	IEA	GO_REF GO_REF
peptidoglycan binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [inference]

N-acetylmuramoyl-L-alanine amidase activity

peptidoglycan muralytic activity [inference]

N-acetylmuramoyl-L-alanine amidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

peptidoglycan binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLQLALVLCGLTLALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLRQIRADHMRRKFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGNFQTGLPPSQMLQAARTLIQIAVQRRQVSPNYSVVGHCQTKATACPGIHLLNELKKWPNWRPKP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
149	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Antimicrobial peptides	Drosophila melanogaster
Neutrophil degranulation	Drosophila melanogaster

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements