GlyCosmos Portal

Submissions

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

Summary

UniProt ID: Q9W125
Gene Symbol: CG3683 Dmel\CG3683 Dmel_CG3683 ND-19 NDUFA8 NUPM Ndufa8 RH23043p
Gene ID: 37946
Organism: Drosophila melanogaster (fruit fly)

External Links

The O-GlcNAc Database: Q9W125
Re-Glyco: Q9W125

Annotation

Keyword: 3D-structure Disulfide bond Mitochondrion inner membrane Oxidoreductase Proteomics identification Reference proteome Repeat Respiratory chain

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
mitochondrial electron transport, NADH to ubiquinone	IC	PMID
mitochondrial electron transport, NADH to ubiquinone	IDA	PMID
mitochondrial electron transport, NADH to ubiquinone	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

cellular respiration [inference]

aerobic respiration [inference]

aerobic electron transport chain [inference]

mitochondrial electron transport, NADH to ubiquinone

electron transport chain [inference]

respiratory electron transport chain [inference]

aerobic electron transport chain [inference]

mitochondrial electron transport, NADH to ubiquinone

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrial inner membrane	IC	PMID PMID
mitochondrial inner membrane	IEA	GO_REF
respiratory chain complex I	ISS	GO_REF
respiratory chain complex I	NAS	PMID
respiratory chain complex I	IDA	PMID PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

NADH dehydrogenase complex [inference]

respiratory chain complex I

transmembrane transporter complex [inference]

respiratory chain complex I

respiratory chain complex [inference]

respiratory chain complex I

catalytic complex [inference]

oxidoreductase complex [inference]

NADH dehydrogenase complex [inference]

respiratory chain complex I

transporter complex [inference]

transmembrane transporter complex [inference]

respiratory chain complex I

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

Displaying 1 entry
GO Term	Evidence Code	Reference
oxidoreductase activity

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVITNNTTLPEESELNVQELNLSSAALRAGAFHLGKQCEQANNEFMLCRQELDDPRACLAEGKAVTSCALDFFRKVKKTCHEEFTQYATCLDKSSGTMAFSHCRKTQGVFDKCIKDNFDWDRPSYGYFSRAKVIQSAREAPKKEEKVSYPDATPGLPEDYPKPPAKYGSRFHWLE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites