GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

LD36772p

Summary

UniProt ID: Q9W158
Gene Symbol: CG4612 Dmel\CG4612 Dmel_CG4612 cg4612
Gene ID: 37914
Organism: Drosophila melanogaster (fruit fly)

External Links

The O-GlcNAc Database: Q9W158
Re-Glyco: Q9W158

Annotation

Keyword: Coiled coil Proteomics identification RNA-binding Reference proteome Repeat

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
long-term memory	IMP	PMID
positive regulation of translation	IDA	PMID

GO Hierarchy

biological process

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

memory [inference]

long-term memory

behavior [inference]

learning or memory [inference]

memory [inference]

long-term memory

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

positive regulation of translation

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

positive regulation of translation

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of protein metabolic process [inference]

regulation of translation [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of translation [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

Displaying **all 4** entries
GO Term	Evidence Code	Reference
nucleus	IBA	GO_REF
cytosol	IBA	GO_REF
cytoplasmic stress granule	IBA	GO_REF
ribonucleoprotein complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

ribonucleoprotein complex

cellular anatomical structure [inference]

cytosol

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic stress granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic stress granule

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic stress granule

Displaying **all 4** entries
GO Term	Evidence Code	Reference
mRNA binding	ISS	PMID
mRNA 3'-UTR binding	IBA	GO_REF
poly(A) binding	ISS	PMID
poly(U) RNA binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

RNA binding [inference]

single-stranded RNA binding [inference]

poly-pyrimidine tract binding [inference]

poly(U) RNA binding

poly-purine tract binding [inference]

poly(A) binding

mRNA 3'-UTR binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFVNSMTFRGNPANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQIFYY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
7		40245499	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
AUF1 (hnRNP D0) binds and destabilizes mRNA	Drosophila melanogaster
Deadenylation of mRNA	Drosophila melanogaster
L13a-mediated translational silencing of Ceruloplasmin expression	Drosophila melanogaster
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)	Drosophila melanogaster
Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)	Drosophila melanogaster
Translation initiation complex formation	Drosophila melanogaster

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026